move env.h -> scripts/

... comes back in next days puzzles (my guess is that it will ;-)

2020/day03/ex2-c.c

@@ -32,7 +32,7 @@ int main(ac, av)
     char **av;
 {
     int line=1, linelen=0, mod=0, i;
-    unsigned long res=1;
+    unsigned long long res=1;
     char str[80];
 
     scanf("%s", str);          /* ignore 1st line */
@@ -51,6 +51,6 @@ int main(ac, av)
     }
     for (i=0; set[i].dx != -1; ++i)
         res*=set[i].count;
-    printf ("%s : lines=%d res=%lu\n", *av, line, res);
+    printf ("%s : lines=%d res=%llu\n", *av, line, res);
     exit (0);
 }

2020/day10/ex1-c.c

@@ -63,7 +63,6 @@ struct list *add_val(list, val)
     struct list *list;
     unsigned long long val;
 {
-    //int val;
     unsigned cur, size;
     unsigned long long *ptr;
 
@@ -80,7 +79,6 @@ struct list *add_val(list, val)
         size+=BLOCKSIZE;
         list->size=size;
         list->list=realloc(list->list, sizeof(unsigned long long)*size);
-        fprintf(stderr, "realloc buf: cur=%d size=%d ptr=%p\n", cur, size, list->list);
     }
     ptr=list->list+cur;
 
@@ -91,10 +89,10 @@ struct list *add_val(list, val)
     return list;
 }
 
-unsigned *calc(list)
+unsigned long long *calc(list)
     struct list *list;
 {
-    static unsigned res[4];
+    static unsigned long long res[4];
     unsigned long long *ptr=list->list;
     unsigned last=list->last, i;
 
@@ -113,10 +111,9 @@ int main(ac, av)
 {
     char line[80];
     struct list *list=NULL;
-    unsigned long long res, last;
+    unsigned long long res, last, *result;
-    unsigned *result;
 
-    list=add_val(list, 0);
+    list=add_val(list, 0llu);
     while (fgets(line, sizeof line, stdin)) {
         sscanf(line, "%llu", &res);
         list=add_val(list, res);
@@ -126,7 +123,7 @@ int main(ac, av)
     list=add_val(list, last+3);
     //print_list(list);
     result=calc(list);
-    printf("%s : diff1=%u diff2=%u res=%u\n", *av, result[1], result[3],
+    printf("%s : diff1=%llu diff2=%llu res=%llu\n", *av, result[1], result[3],
            result[1]*result[3]);
     exit (0);
 }

2020/day10/ex2-c.c

@@ -131,7 +131,7 @@ int main(ac, av)
     struct list *list=NULL;
     unsigned long long res, last;
 
-    list=add_val(list, 0);
+    list=add_val(list, 0ll);
     while (fgets(line, sizeof line, stdin)) {
         sscanf(line, "%llu", &res);
         list=add_val(list, res);

2020/day11/ex1-slow.bash

@@ -12,9 +12,9 @@ declare floor
 
 function adj() {
 	local -i r="$1" n="$2" c="$3" count=0
-	local -a prow=(${rows[r-1]})
+	local -a prow=("${rows[r-1]}")
-	local -a row=(${rows[r]})
+	local -a row=("${rows[r]}")
-	local -a nrow=(${rows[r+1]})
+	local -a nrow=("${rows[r+1]}")
 	#echo
 	#echo p="${prow[*]}"
 	#echo r="${row[*]}"
@@ -51,7 +51,7 @@ function run() {
 		changed=0
 		seated=0
 		for ((r=1; r<=NROWS; ++r)); do
-			row=(${rows[r]})
+			row=("${rows[r]}")
 			newrow=(0)
 			for ((c=1; c<=RLENGTH; ++c)); do
 				newrow+=("${row[c]}")
@@ -61,13 +61,13 @@ function run() {
 				case ${row[c]} in
 					0) continue
 					   ;;
-					1) if (( $(adj $r $c 2) == 0 )); then
+					1) if (( $(adj "$r" "$c" 2) == 0 )); then
 						   ((++changed))
 						   newrow[c]=2
 					   fi
 					   #printf "[%d][%d]: %s %s %d\n" $r $c "${row[c]}" "${newrow[c]}" $(adj $r $c 2)
 					   ;;
-					2) if (( $(adj $r $c 2) >= 4 )); then
+					2) if (( $(adj "$r" "$c" 2) >= 4 )); then
 						   ((++changed))
 						   newrow[c]=1
 					   fi

2020/include/bits.h

@@ -10,8 +10,8 @@
  * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
  *
  */
-#ifndef BITS_H
+#ifndef _BITS_H
-#define BITS_H
+#define _BITS_H
 
 #include <stdint.h>
 #include <stdbool.h>
@@ -26,9 +26,11 @@
 
 /* no plan to support 32bits for now...
  */
+/*
 #if __WORDSIZE != 64
 #error "Only 64 bits word size supported."
 #endif
+*/
 
 /* fixed-size types
  */
@@ -49,6 +51,51 @@ typedef unsigned int uint;
 typedef unsigned short ushort;
 typedef unsigned char uchar;
 
+/* count set bits:  10101000 -> 3
+ *                  ^ ^ ^
+ */
+static __always_inline int popcount64(u64 n)
+{
+#   if __has_builtin(__builtin_popcountl)
+#   ifdef DEBUG_BITS
+    log_f(1, "builtin.\n");
+#   endif
+    return __builtin_popcountl(n);
+
+#   else
+#   ifdef DEBUG_BITS
+    log_f(1, "emulated.\n");
+#   endif
+    int count = 0;
+    while (n) {
+        count++;
+        n &= (n - 1);
+    }
+    return count;
+#   endif
+}
+
+static __always_inline int popcount32(u32 n)
+{
+#   if __has_builtin(__builtin_popcount)
+#   ifdef DEBUG_BITS
+    log_f(1, "builtin.\n");
+#   endif
+    return __builtin_popcount(n);
+
+#   else
+#   ifdef DEBUG_BITS
+    log_f(1, "emulated.\n");
+#   endif
+    int count = 0;
+    while (n) {
+        count++;
+        n &= (n - 1);
+    }
+    return count;
+#   endif
+}
+
 /* char is a special case, as it can be signed or unsigned
  */
 typedef signed char schar;
@@ -74,7 +121,7 @@ static __always_inline int ctz64(u64 n)
 #   ifdef DEBUG_BITS
     log_f(1, "emulated.\n");
 #   endif
-    return popcount64((n & −n) − 1);
+    return popcount64((n & -n) - 1);
 #   endif
 }
 
@@ -96,7 +143,7 @@ static __always_inline int ctz32(u32 n)
 #   ifdef DEBUG_BITS
     log_f(1, "emulated.\n");
 #   endif
-    return popcount32((n & −n) − 1);
+    return popcount32((n & -n) - 1);
 #   endif
 }
 
@@ -218,51 +265,6 @@ static __always_inline uint ffs32(u32 n)
 #   endif
 }
 
-/* count set bits:  10101000 -> 3
- *                  ^ ^ ^
- */
-static __always_inline int popcount64(u64 n)
-{
-#   if __has_builtin(__builtin_popcountl)
-#   ifdef DEBUG_BITS
-    log_f(1, "builtin.\n");
-#   endif
-    return __builtin_popcountl(n);
-
-#   else
-#   ifdef DEBUG_BITS
-    log_f(1, "emulated.\n");
-#   endif
-    int count = 0;
-    while (n) {
-        count++;
-        n &= (n - 1);
-    }
-    return count;
-#   endif
-}
-
-static __always_inline int popcount32(u32 n)
-{
-#   if __has_builtin(__builtin_popcount)
-#   ifdef DEBUG_BITS
-    log_f(1, "builtin.\n");
-#   endif
-    return __builtin_popcount(n);
-
-#   else
-#   ifdef DEBUG_BITS
-    log_f(1, "emulated.\n");
-#   endif
-    int count = 0;
-    while (n) {
-        count++;
-        n &= (n - 1);
-    }
-    return count;
-#   endif
-}
-
 /*  rolXX are taken from kernel's <linux/bitops.h> are are:
  * SPDX-License-Identifier: GPL-2.0
  */
@@ -518,4 +520,4 @@ int __bits_per(unsigned long n)
 #define bit_for_each32_2(pos, tmp, ul)                                  \
     for (tmp = ul, pos = ctz32(tmp); tmp; tmp ^= 1U << pos, pos = ctz32(tmp))
 
-#endif  /* BITS_H */
+#endif  /* _BITS_H */

2020/include/br.h

@@ -1,4 +1,4 @@
-/* bits.h - bits functions.
+/* br.h - misc macros.
  *
  * Copyright (C) 2021-2022 Bruno Raoult ("br")
  * Licensed under the GNU General Public License v3.0 or later.
@@ -18,12 +18,18 @@
 #ifndef _BR_H
 #define _BR_H
 
+/* Indirect stringification.  Doing two levels allows the parameter to be a
+ * macro itself.  For example, compile with -DFOO=bar, __stringify(FOO)
+ * converts to "bar".
+ */
+#define __stringify_1(x...)	#x
+#define __stringify(x...)	__stringify_1(x)
+
 /* generate a (maybe) unique id.
  */
 #define ___PASTE(x, y)      x##y
 #define __PASTE(x, y)       ___PASTE(x, y)
 #define __UNIQUE_ID(prefix) __PASTE(__PASTE(__UNIQUE_ID_, prefix), __COUNTER__)
-//__##prefix##__COUNTER__
 
 /* see https://lkml.org/lkml/2018/3/20/845 for explanation of this monster
  */

2020/libsrc/debug.c

@@ -1,6 +1,6 @@
 /* debug.c - debug/log management
  *
- * Copyright (C) 2021 Bruno Raoult ("br")
+ * Copyright (C) 2021-2022 Bruno Raoult ("br")
  * Licensed under the GNU General Public License v3.0 or later.
  * Some rights reserved. See COPYING.
  *
@@ -19,12 +19,14 @@
 #define DEBUG_DEBUG
 #endif
 
+#include "bits.h"
 #include "debug.h"
 
-#define NANOSEC  1000000000                       /* nano sec in sec */
+#define NS_SEC   1000000000                       /* nano sec in sec */
-#define MILLISEC 1000000                          /* milli sec in sec */
+#define MS_SEC   1000000                          /* microsec in sec */
+#define NS_MS    1000                             /* nano in micro */
 
-static s64 timer_start;                           /* in nanosecond */
+static long long timer_start;                     /* in nanosecond */
 static u32 debug_level=0;
 
 void debug_level_set(u32 level)
@@ -40,7 +42,7 @@ void debug_init(u32 level)
 
     debug_level_set(level);
     if (!clock_gettime(CLOCK_MONOTONIC, &timer)) {
-        timer_start = timer.tv_sec * NANOSEC + timer.tv_nsec;
+        timer_start = timer.tv_sec * NS_SEC + timer.tv_nsec;
     }
     else {
         timer_start = 0;
@@ -48,15 +50,14 @@ void debug_init(u32 level)
     log(0, "timer started.\n");
 }
 
-inline static s64 timer_elapsed()
+inline static long long timer_elapsed()
 {
     struct timespec timer;
 
     clock_gettime(CLOCK_MONOTONIC, &timer);
-    return (timer.tv_sec * NANOSEC + timer.tv_nsec) - timer_start;
+    return (timer.tv_sec * NS_SEC + timer.tv_nsec) - timer_start;
 }
 
-
 /* void debug - log function
  * @timestamp : boolean
  * @indent    : indent level (2 spaces each)
@@ -75,9 +76,9 @@ void debug(u32 level, bool timestamp, u32 indent, const char *src,
         printf("%*s", 2*(indent-1), "");
 
     if (timestamp) {
-        s64 diff = timer_elapsed();
+        long long diff = timer_elapsed();
-        printf("%ld.%03ld ", diff/NANOSEC, (diff/1000000)%1000);
+        printf("%lld.%03lld ", diff / NS_SEC, (diff % NS_SEC) / NS_MS);
-        printf("%010ld ", diff);
+        printf("%010lldμs ", diff / NS_MS);
     }
 
     if (src) {

2020/libsrc/pool.c

@@ -1,6 +1,6 @@
 /* pool.c - A simple pool manager.
  *
- * Copyright (C) 2021 Bruno Raoult ("br")
+ * Copyright (C) 2021-2022 Bruno Raoult ("br")
  * Licensed under the GNU General Public License v3.0 or later.
  * Some rights reserved. See COPYING.
  *
@@ -25,18 +25,16 @@
 void pool_stats(pool_t *pool)
 {
     if (pool) {
-#       ifdef DEBUG_POOL
         block_t *block;
 
-        log_f(1, "[%s] pool [%p]: blocks:%u avail:%u alloc:%u grow:%u eltsize:%lu\n",
+        log_f(1, "[%s] pool [%p]: blocks:%u avail:%u alloc:%u grow:%u eltsize:%zu\n",
-              pool->name, (void *)pool, pool->nblocks, pool->available, pool->allocated,
+              pool->name, (void *)pool, pool->nblocks, pool->available,
-              pool->growsize, pool->eltsize);
+              pool->allocated, pool->growsize, pool->eltsize);
         log(5, "\tblocks: ");
         list_for_each_entry(block, &pool->list_blocks, list_blocks) {
             log(5, "%p ", block);
         }
         log(5, "\n");
-#       endif
     }
 }
 
@@ -45,14 +43,13 @@ pool_t *pool_create(const char *name, u32 growsize, size_t eltsize)
     pool_t *pool;
 
 #   ifdef DEBUG_POOL
-    log_f(1, "name=[%s] growsize=%u eltsize=%lu\n",
+    log_f(1, "name=[%s] growsize=%u eltsize=%zu\n", name, growsize, eltsize);
-          name, growsize, eltsize);
 #   endif
     /* we need at least  sizeof(struct list_head) space in pool elements
      */
     if (eltsize < sizeof (struct list_head)) {
 #       ifdef DEBUG_POOL
-        log_f(1, "[%s]: structure size too small (%lu < %lu), adjusting to %lu.\n",
+        log_f(1, "[%s]: structure size too small (%zu < %zu), adjusting to %zu.\n",
               name, eltsize, sizeof(struct list_head), sizeof(struct list_head));
 #       endif
         eltsize = sizeof(struct list_head);
@@ -67,6 +64,8 @@ pool_t *pool_create(const char *name, u32 growsize, size_t eltsize)
         pool->nblocks = 0;
         INIT_LIST_HEAD(&pool->list_available);
         INIT_LIST_HEAD(&pool->list_blocks);
+    } else {
+        errno = ENOMEM;
     }
     return pool;
 }
@@ -74,11 +73,9 @@ pool_t *pool_create(const char *name, u32 growsize, size_t eltsize)
 static u32 _pool_add(pool_t *pool, struct list_head *elt)
 {
 #   ifdef DEBUG_POOL
-    log_f(6, "pool=%p &head=%p elt=%p off1=%lu off2=%lu\n",
+    log_f(6, "pool=%p &head=%p elt=%p off1=%zu off2=%zu\n",
-          (void *)pool,
+          (void *)pool, (void *)&pool->list_available, (void *)elt,
-          (void *)&pool->list_available,
+          (void *)&pool->list_available - (void *)pool,
-          (void *)elt,
-          (void *)&pool->list_available-(void *)pool,
           offsetof(pool_t, list_available));
 #   endif
 
@@ -105,9 +102,6 @@ void *pool_get(pool_t *pool)
         return NULL;
     if (!pool->available) {
         block_t *block = malloc(sizeof(block_t) + pool->eltsize * pool->growsize);
-        void *cur;
-        u32 i;
-
         if (!block) {
 #           ifdef DEBUG_POOL
             log_f(1, "[%s]: failed block allocation\n", pool->name);
@@ -131,16 +125,15 @@ void *pool_get(pool_t *pool)
 #       endif
 
         pool->allocated += pool->growsize;
-        for (i = 0; i < pool->growsize; ++i) {
+        for (u32 i = 0; i < pool->growsize; ++i) {
-            cur = block->data + i * pool->eltsize;
+            void *cur = block->data + i * pool->eltsize;
 #           ifdef DEBUG_POOL
             log_f(7, "alloc=%p cur=%p\n", block, cur);
 #           endif
             _pool_add(pool, (struct list_head *)cur);
         }
-        //pool_stats(pool);
     }
-    /* this is the effective address if the object (and also the
+    /* this is the effective address of the object (and also the
      * pool list_head address)
      */
     return _pool_get(pool);
@@ -157,11 +150,11 @@ void pool_destroy(pool_t *pool)
     log(5, "blocks:");
 #   endif
     list_for_each_entry_safe(block, tmp, &pool->list_blocks, list_blocks) {
-        list_del(&block->list_blocks);
-        free(block);
 #       ifdef DEBUG_POOL
         log(5, " %p", block);
 #       endif
+        list_del(&block->list_blocks);
+        free(block);
     }
 #   ifdef DEBUG_POOL
     log(5, "\n");
@@ -221,5 +214,6 @@ int main(int ac, char**av)
         }
     }
     pool_stats(pool);
+    pool_destroy(pool);
 }
 #endif

2022/RESULTS.txt

@@ -5,17 +5,313 @@
 +++++++++++++++++ part 1
 aoc.bash: res=66719
 	time: 0:00.03 real, 0.02 user, 0.00 sys
-	context-switch:	0+1, page-faults: 0+274
+	context-switch:	0+1, page-faults: 0+257
 
-aoc-c : res=66719
+aoc-c: res=66719
 	time: 0:00.00 real, 0.00 user, 0.00 sys
-	context-switch:	0+1, page-faults: 0+89
+	context-switch:	0+1, page-faults: 0+88
 
 +++++++++++++++++ part 2
 aoc.bash: res=198551
 	time: 0:00.03 real, 0.03 user, 0.00 sys
-	context-switch:	2+1, page-faults: 0+283
+	context-switch:	2+1, page-faults: 0+259
 
-aoc-c : res=198551
+aoc-c: res=198551
 	time: 0:00.00 real, 0.00 user, 0.00 sys
-	context-switch:	5+1, page-faults: 0+87
+	context-switch:	0+1, page-faults: 0+87
+
+=========================================
+================= day02 =================
+=========================================
+
++++++++++++++++++ part 1
+aoc.bash: res=11841
+	time: 0:00.05 real, 0.05 user, 0.00 sys
+	context-switch:	7+1, page-faults: 0+273
+
+aoc-c: res=11841
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+87
+
++++++++++++++++++ part 2
+aoc.bash: res=13022
+	time: 0:00.05 real, 0.03 user, 0.01 sys
+	context-switch:	9+1, page-faults: 0+272
+
+aoc-c: res=13022
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+87
+
+=========================================
+================= day03 =================
+=========================================
+
++++++++++++++++++ part 1
+aoc.bash: res=7878
+	time: 0:00.02 real, 0.01 user, 0.00 sys
+	context-switch:	2+1, page-faults: 0+301
+
+aoc-c: res=7878
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+87
+
++++++++++++++++++ part 2
+aoc.bash: res=2760
+	time: 0:00.01 real, 0.01 user, 0.00 sys
+	context-switch:	1+1, page-faults: 0+282
+
+aoc-c: res=2760
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+88
+
+=========================================
+================= day04 =================
+=========================================
+
++++++++++++++++++ part 1
+aoc.bash: res=444
+	time: 0:00.02 real, 0.01 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+258
+
+aoc-c: res=444
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+87
+
++++++++++++++++++ part 2
+aoc.bash: res=801
+	time: 0:00.02 real, 0.01 user, 0.00 sys
+	context-switch:	1+1, page-faults: 0+261
+
+aoc-c: res=801
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+87
+
+=========================================
+================= day05 =================
+=========================================
+
++++++++++++++++++ part 1
+aoc.bash: res=VQZNJMWTR
+	time: 0:00.08 real, 0.06 user, 0.01 sys
+	context-switch:	3+1, page-faults: 0+274
+
+aoc-c: res=VQZNJMWTR
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+87
+
++++++++++++++++++ part 2
+aoc.bash: res=NLCDCLVMQ
+	time: 0:00.04 real, 0.02 user, 0.01 sys
+	context-switch:	20+1, page-faults: 0+274
+
+aoc-c: res=NLCDCLVMQ
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+86
+
+=========================================
+================= day06 =================
+=========================================
+
++++++++++++++++++ part 1
+aoc.bash: res=1658
+	time: 0:00.06 real, 0.06 user, 0.00 sys
+	context-switch:	1+1, page-faults: 0+266
+
+aoc-c: res=1658
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+87
+
++++++++++++++++++ part 2
+aoc.bash: res=2260
+	time: 0:00.09 real, 0.09 user, 0.00 sys
+	context-switch:	1+1, page-faults: 0+265
+
+aoc-c: res=2260
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+87
+
+=========================================
+================= day07 =================
+=========================================
+
++++++++++++++++++ part 1
+aoc.bash: res=1390824
+	time: 0:00.05 real, 0.03 user, 0.01 sys
+	context-switch:	7+1, page-faults: 0+307
+
+aoc-c: res=1390824
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+98
+
++++++++++++++++++ part 2
+aoc.bash: res=7490863
+	time: 0:00.05 real, 0.05 user, 0.00 sys
+	context-switch:	9+1, page-faults: 0+308
+
+aoc-c: res=7490863
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+98
+
+=========================================
+================= day08 =================
+=========================================
+
++++++++++++++++++ part 1
+aoc.bash: res=1698
+	time: 0:01.10 real, 1.10 user, 0.00 sys
+	context-switch:	5+1, page-faults: 0+319
+
+aoc-c: res=1698
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+92
+
++++++++++++++++++ part 2
+aoc.bash: res=672280
+	time: 0:03.54 real, 3.53 user, 0.00 sys
+	context-switch:	48+1, page-faults: 0+284
+
+aoc-c: res=672280
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+91
+
+=========================================
+================= day09 =================
+=========================================
+
++++++++++++++++++ part 1
+aoc.bash: res=5619
+	time: 0:00.69 real, 0.69 user, 0.00 sys
+	context-switch:	38+1, page-faults: 0+430
+
+aoc-c: res=5619
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+158
+
++++++++++++++++++ part 2
+aoc.bash: res=2376
+	time: 0:03.25 real, 3.24 user, 0.00 sys
+	context-switch:	46+1, page-faults: 0+340
+
+aoc-c: res=2376
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+131
+
+=========================================
+================= day10 =================
+=========================================
+
++++++++++++++++++ part 1
+aoc.bash: res=13220
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+260
+
+aoc-c: res=13220
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+88
+
++++++++++++++++++ part 2
+aoc.bash: res=
+###..#..#..##..#..#.#..#.###..####.#..##
+#..#.#..#.#..#.#.#..#..#.#..#.#....#.#..
+#..#.#..#.#..#.##...####.###..###..##..#
+###..#..#.####.#.#..#..#.#..#.#....#.#.#
+#.#..#..#.#..#.#.#..#..#.#..#.#....#.#..
+#..#..##..#..#.#..#.#..#.###..####.#..#.
+	time: 0:00.01 real, 0.00 user, 0.00 sys
+	context-switch:	3+1, page-faults: 0+262
+
+###..#..#..##..#..#.#..#.###..####.#..##
+#..#.#..#.#..#.#.#..#..#.#..#.#....#.#..
+#..#.#..#.#..#.##...####.###..###..##..#
+###..#..#.####.#.#..#..#.#..#.#....#.#.#
+#.#..#..#.#..#.#.#..#..#.#..#.#....#.#..
+#..#..##..#..#.#..#.#..#.###..####.#..#.
+aoc-c: res=0
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+88
+
+=========================================
+================= day11 =================
+=========================================
+
++++++++++++++++++ part 1
+aoc.bash: res=54253
+	time: 0:00.05 real, 0.04 user, 0.00 sys
+	context-switch:	1+1, page-faults: 0+268
+
+aoc-c: res=54253
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+87
+
++++++++++++++++++ part 2
+aoc.bash: res=13119526120
+	time: 0:16.49 real, 16.48 user, 0.00 sys
+	context-switch:	106+1, page-faults: 0+270
+
+aoc-c: res=13119526120
+	time: 0:00.01 real, 0.01 user, 0.00 sys
+	context-switch:	13+1, page-faults: 0+87
+
+=========================================
+================= day12 =================
+=========================================
+
++++++++++++++++++ part 1
+aoc.bash: res=408
+	time: 0:00.81 real, 0.80 user, 0.00 sys
+	context-switch:	223+1, page-faults: 0+486
+
+aoc-c: res=408
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+170
+
++++++++++++++++++ part 2
+aoc.bash: res=399
+	time: 0:00.55 real, 0.54 user, 0.01 sys
+	context-switch:	25+1, page-faults: 0+460
+
+aoc-c: res=399
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+171
+
+=========================================
+================= day13 =================
+=========================================
+
++++++++++++++++++ part 1
+aoc-c: res=5843
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+192
+
++++++++++++++++++ part 2
+aoc-c: res=26289
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	1+1, page-faults: 0+190
+
+=========================================
+================= day14 =================
+=========================================
+
++++++++++++++++++ part 1
+aoc-c: res=665
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+109
+
++++++++++++++++++ part 2
+aoc-c: res=25434
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+121
+
+=========================================
+================= day15 =================
+=========================================
+
++++++++++++++++++ part 1
+aoc-c: res=5176944
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+152
+
++++++++++++++++++ part 2
+aoc-c: res=13350458933732
+	time: 0:00.00 real, 0.00 user, 0.00 sys
+	context-switch:	0+1, page-faults: 0+88

2022/day01/aoc-c.c

@@ -71,7 +71,7 @@ int main(int ac, char **av)
     pool_t *pool_tot = pool_create("total", 128, sizeof(struct plist_node));
     parse(pool_tot);
 
-    printf("%s : res=%d\n", *av, calc_top_plist(part == 1? 1: 3));
+    printf("%s: res=%d\n", *av, calc_top_plist(part == 1? 1: 3));
     pool_destroy(pool_tot);
     exit(0);
 }

2022/day01/common.bash

@@ -15,6 +15,7 @@
 export cmdname=${0##*/}
 export debug=0
 export res
+export LANG=C
 
 shopt -s extglob
 set -o noglob
@@ -25,7 +26,7 @@ usage() {
 }
 
 checkargs() {
-    local part
+    local part=1
     while getopts p:d: todo; do
         case "$todo" in
             d)

2022/day02/Makefile

@@ -0,0 +1,111 @@
+# AOC daily Makefile - GNU make only.
+#
+# Copyright (C) 2021-2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+#
+
+INPUT   := input/input.txt
+SHELL   := /bin/bash
+
+CC      := gcc
+BEAR    := bear
+CCLSFILE:= compile_commands.json
+
+LIB     := aoc_$(shell uname -m)
+INCDIR  := ../include
+LIBDIR  := ../lib
+LDFLAGS := -L$(LIBDIR)
+#LDLIB   := -l$(LIB) -lm
+LDLIB   := -l$(LIB)
+
+export LD_LIBRARY_PATH = $(LIBDIR)
+
+CFLAGS  += -std=gnu11
+CFLAGS  += -O2
+CFLAGS  += -g
+# for gprof
+# CFLAGS += -pg
+CFLAGS  += -Wall
+CFLAGS  += -Wextra
+CFLAGS  += -march=native
+# Next one may be useful for valgrind (some invalid instructions)
+# CFLAGS += -mno-tbm
+CFLAGS  += -Wmissing-declarations
+CFLAGS  += -Wno-unused-result
+
+CFLAGS  += -DDEBUG_DEBUG 	# activate general debug (debug.c)
+CFLAGS  += -DDEBUG_POOL		# memory pools management
+
+VALGRIND := valgrind
+VALGRINDFLAGS := --leak-check=full --show-leak-kinds=all --track-origins=yes \
+	--sigill-diagnostics=yes --quiet --show-error-list=yes
+
+
+TIME    := \time -f "\ttime: %E real, %U user, %S sys\n\tcontext-switch:\t%c+%w, page-faults: %F+%R\n"
+export PATH := .:$(PATH)
+
+.PHONY: clean all compile assembly memcheck memcheck1 memcheck2 part1 part2 ccls bear org
+
+all: README.org ccls part1 part2
+
+memcheck: memcheck1 memcheck2
+
+memcheck1: aoc-c
+	@$(VALGRIND) $(VALGRINDFLAGS) aoc-c -p 1 < $(INPUT)
+
+memcheck2: aoc-c
+	@$(VALGRIND) $(VALGRINDFLAGS) aoc-c -p 2 < $(INPUT)
+	@#@valgrind -s --track-origins=yes aoc-c -p 2 < $(INPUT)
+
+compile: aoc-c
+
+cpp: aoc-c.i
+
+assembly: aoc-c.s
+
+part1: aoc-c
+	@$(TIME) aoc.bash -p 1 < $(INPUT) 2>&1
+	@$(TIME) aoc-c -p 1 < $(INPUT)
+
+part2: aoc-c
+	@$(TIME) aoc.bash -p 2 < $(INPUT) 2>&1
+	@$(TIME) aoc-c -p 2 < $(INPUT)
+
+ccls: $(CCLSFILE)
+
+clean:
+	@rm -f aoc-c core* vgcore* gmon.out aoc-c.s aoc-c.i README.html compile_commands.json
+
+aoc-c: aoc-c.c common.c
+	@echo compiling $<
+	$(CC) $(CFLAGS) $(LDFLAGS) -I $(INCDIR) $^ $(LDLIB) -o $@
+
+# generate pre-processed file (.i) and assembler (.s)
+%.i: %.c
+	@echo generating $@
+	@$(CC) -E $(CFLAGS) -I $(INCDIR) $< -o $@
+
+%.s: %.c
+	@echo generating $@
+	@$(CC) -S -fverbose-asm $(CFLAGS) -I $(INCDIR) $< -o $@
+
+# generate README.org from README.html (must cleanup !)
+org: README.org
+
+%.org: %.html
+	@echo generating $@. Cleanup before commit !
+	@pandoc $< -o $@
+
+# generate compile_commands.json
+$(CCLSFILE): aoc-c.c Makefile
+	$(BEAR) -- make clean compile
+
+bear: clean
+	@touch .ccls-root
+	@$(BEAR) -- make compile

2022/day02/README.org

@@ -0,0 +1,89 @@
+** --- Day 2: Rock Paper Scissors ---
+The Elves begin to set up camp on the beach. To decide whose tent gets
+to be closest to the snack storage, a giant
+[[https://en.wikipedia.org/wiki/Rock_paper_scissors][Rock Paper
+Scissors]] tournament is already in progress.
+
+Rock Paper Scissors is a game between two players. Each game contains
+many rounds; in each round, the players each simultaneously choose one
+of Rock, Paper, or Scissors using a hand shape. Then, a winner for that
+round is selected: Rock defeats Scissors, Scissors defeats Paper, and
+Paper defeats Rock. If both players choose the same shape, the round
+instead ends in a draw.
+
+Appreciative of your help yesterday, one Elf gives you an /encrypted
+strategy guide/ (your puzzle input) that they say will be sure to help
+you win. "The first column is what your opponent is going to play: =A=
+for Rock, =B= for Paper, and =C= for Scissors. The second column--"
+Suddenly, the Elf is called away to help with someone's tent.
+
+The second column, you reason, must be what you should play in response:
+=X= for Rock, =Y= for Paper, and =Z= for Scissors. Winning every time
+would be suspicious, so the responses must have been carefully chosen.
+
+The winner of the whole tournament is the player with the highest score.
+Your /total score/ is the sum of your scores for each round. The score
+for a single round is the score for the /shape you selected/ (1 for
+Rock, 2 for Paper, and 3 for Scissors) plus the score for the /outcome
+of the round/ (0 if you lost, 3 if the round was a draw, and 6 if you
+won).
+
+Since you can't be sure if the Elf is trying to help you or trick you,
+you should calculate the score you would get if you were to follow the
+strategy guide.
+
+For example, suppose you were given the following strategy guide:
+
+#+begin_example
+A Y
+B X
+C Z
+#+end_example
+
+This strategy guide predicts and recommends the following:
+
+- In the first round, your opponent will choose Rock (=A=), and you
+  should choose Paper (=Y=). This ends in a win for you with a score of
+  /8/ (2 because you chose Paper + 6 because you won).
+- In the second round, your opponent will choose Paper (=B=), and you
+  should choose Rock (=X=). This ends in a loss for you with a score of
+  /1/ (1 + 0).
+- The third round is a draw with both players choosing Scissors, giving
+  you a score of 3 + 3 = /6/.
+
+In this example, if you were to follow the strategy guide, you would get
+a total score of =15= (8 + 1 + 6).
+
+/What would your total score be if everything goes exactly according to
+your strategy guide?/
+
+Your puzzle answer was =11841=.
+
+** --- Part Two ---
+The Elf finishes helping with the tent and sneaks back over to you.
+"Anyway, the second column says how the round needs to end: =X= means
+you need to lose, =Y= means you need to end the round in a draw, and =Z=
+means you need to win. Good luck!"
+
+The total score is still calculated in the same way, but now you need to
+figure out what shape to choose so the round ends as indicated. The
+example above now goes like this:
+
+- In the first round, your opponent will choose Rock (=A=), and you need
+  the round to end in a draw (=Y=), so you also choose Rock. This gives
+  you a score of 1 + 3 = /4/.
+- In the second round, your opponent will choose Paper (=B=), and you
+  choose Rock so you lose (=X=) with a score of 1 + 0 = /1/.
+- In the third round, you will defeat your opponent's Scissors with Rock
+  for a score of 1 + 6 = /7/.
+
+Now that you're correctly decrypting the ultra top secret strategy
+guide, you would get a total score of =12=.
+
+Following the Elf's instructions for the second column, /what would your
+total score be if everything goes exactly according to your strategy
+guide?/
+
+Your puzzle answer was =13022=.
+
+Both parts of this puzzle are complete! They provide two gold stars: **

2022/day02/aoc-c.c

@@ -0,0 +1,64 @@
+/* aoc-c.c: Advent of Code 2022, day 2
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <unistd.h>
+
+#include "plist.h"
+#include "debug.h"
+#include "pool.h"
+#include "aoc.h"
+
+/* we will use the following convention, for input line "a x":
+ * position in array=(a-'A' * 3) + x - 'X'
+ */
+enum {
+    A = 0, B, C,
+    X = 0, Y, Z
+};
+#define pos(x, y) ((x) * 3 + (y))
+
+int outcome[2][9] = {                             /* shape is known */
+    {
+        [pos(A, X)] = 3 + 1, [pos(A, Y)] = 6 + 2, [pos(A, Z)] = 0 + 3,
+        [pos(B, X)] = 0 + 1, [pos(B, Y)] = 3 + 2, [pos(B, Z)] = 6 + 3,
+        [pos(C, X)] = 6 + 1, [pos(C, Y)] = 0 + 2, [pos(C, Z)] = 3 + 3
+    },
+    {                                             /* result is known */
+        [pos(A, X)] = 0 + 3, [pos(A, Y)] = 3 + 1, [pos(A, Z)] = 6 + 2,
+        [pos(B, X)] = 0 + 1, [pos(B, Y)] = 3 + 2, [pos(B, Z)] = 6 + 3,
+        [pos(C, X)] = 0 + 2, [pos(C, Y)] = 3 + 3, [pos(C, Z)] = 6 + 1
+    }
+};
+
+static int *parse(int *res)
+{
+    size_t alloc = 0;
+    char *buf = NULL;
+    ssize_t buflen;
+
+    while ((buflen = getline(&buf, &alloc, stdin)) > 0) {
+        for (int i = 0; i < 2; ++i)
+            res[i] += outcome[i][pos(buf[0] - 'A', buf[2] - 'X')];
+    }
+    free(buf);
+    return res;
+}
+
+int main(int ac, char **av)
+{
+    int res[2] = { 0, 0 };
+
+    printf("%s: res=%d\n", *av, parse(res)[parseargs(ac, av) - 1]);
+    exit(0);
+}

2022/day02/aoc.bash

@@ -0,0 +1,42 @@
+#!/usr/bin/env bash
+#
+# aoc.bash: Advent of Code 2022, day 2
+#
+# Copyright (C) 2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+
+. common.bash
+
+declare -A outcome=(                              # shape is known
+    [A X]=$((3+1)) [A Y]=$((6+2)) [A Z]=$((0+3))
+    [B X]=$((0+1)) [B Y]=$((3+2)) [B Z]=$((6+3))
+    [C X]=$((6+1)) [C Y]=$((0+2)) [C Z]=$((3+3))
+)
+declare -A outcome2=(                              # result is known
+    [A X]=$((0+3)) [A Y]=$((3+1)) [A Z]=$((6+2))
+    [B X]=$((0+1)) [B Y]=$((3+2)) [B Z]=$((6+3))
+    [C X]=$((0+2)) [C Y]=$((3+3)) [C Z]=$((6+1))
+)
+declare -a tot
+
+parse() {
+    local input
+
+    while read -r input; do
+        (( tot[1] += outcome[$input] ))
+        (( tot[2] += outcome2[$input] ))
+    done
+}
+
+solve() {
+    res="${tot[$1]}"
+}
+
+main "$@"
+exit 0

2022/day02/aoc.h

@@ -0,0 +1,17 @@
+/* aoc.c: Advent of Code 2022
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+#ifndef _AOC_H_
+#define _AOC_H_
+
+extern int parseargs(int ac, char**av);
+
+#endif  /* _AOC_H_ */

2022/day02/common.bash

@@ -0,0 +1,68 @@
+#!/usr/bin/env bash
+#
+# common.bash: Advent of Code 2022, common bash functions
+#
+# Copyright (C) 2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+
+# shellcheck disable=2034
+export cmdname=${0##*/}
+export debug=0
+export res
+export LANG=C
+
+shopt -s extglob
+set -o noglob
+
+usage() {
+    printf "usage: %s [-d DEBUG] [-p PART]\n" "$cmdname"
+    exit 1
+}
+
+checkargs() {
+    local part=1
+    while getopts p:d: todo; do
+        case "$todo" in
+            d)
+                if [[ "$OPTARG" =~ ^[[:digit:]+]$ ]]; then
+                    debug="$OPTARG"
+                else
+                    printf "%s: illegal [%s] debug level.\n" "$CMD" "$OPTARG"
+                    exit 1
+                fi
+                ;;
+            p)
+                if [[ "$OPTARG" =~ ^[12]$ ]]; then
+                    part="$OPTARG"
+                else
+                    printf "%s: illegal [%s] part.\n" "$CMD" "$OPTARG"
+                    exit 1
+                fi
+                ;;
+            *)
+                usage
+                ;;
+        esac
+    done
+    # Now check remaining argument (backup directory)
+    shift $((OPTIND - 1))
+
+    (( $# > 1 )) && usage
+    return "$part"
+}
+
+main() {
+    local -i part
+
+    checkargs "$@"
+    part=$?
+    parse "$part"
+    solve "$part"
+    printf "%s: res=%s\n" "$cmdname" "$res"
+}

2022/day02/common.c

@@ -0,0 +1,49 @@
+/* common.c: Advent of Code 2022, common functions
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <unistd.h>
+
+#include "aoc.h"
+#include "debug.h"
+
+static int usage(char *prg)
+{
+    fprintf(stderr, "Usage: %s [-d debug_level] [-p part] [-i input]\n", prg);
+    return 1;
+}
+
+int parseargs(int ac, char **av)
+{
+    int opt, part = 1;
+
+    while ((opt = getopt(ac, av, "d:p:")) != -1) {
+        switch (opt) {
+            case 'd':
+                debug_level_set(atoi(optarg));
+                break;
+            case 'p':                             /* 1 or 2 */
+                part = atoi(optarg);
+                if (part < 1 || part > 2)
+                    return usage(*av);
+                break;
+            case 'i':
+
+            default:
+                return usage(*av);
+        }
+    }
+    if (optind < ac)
+        return usage(*av);
+    return part;
+}

2022/day02/input/example.txt

@@ -0,0 +1,3 @@
+A Y
+B X
+C Z

2022/day03/Makefile

@@ -0,0 +1,111 @@
+# AOC daily Makefile - GNU make only.
+#
+# Copyright (C) 2021-2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+#
+
+INPUT   := input/input.txt
+SHELL   := /bin/bash
+
+CC      := gcc
+BEAR    := bear
+CCLSFILE:= compile_commands.json
+
+LIB     := aoc_$(shell uname -m)
+INCDIR  := ../include
+LIBDIR  := ../lib
+LDFLAGS := -L$(LIBDIR)
+#LDLIB   := -l$(LIB) -lm
+LDLIB   := -l$(LIB)
+
+export LD_LIBRARY_PATH = $(LIBDIR)
+
+CFLAGS  += -std=gnu11
+CFLAGS  += -O2
+CFLAGS  += -g
+# for gprof
+# CFLAGS += -pg
+CFLAGS  += -Wall
+CFLAGS  += -Wextra
+CFLAGS  += -march=native
+# Next one may be useful for valgrind (some invalid instructions)
+# CFLAGS += -mno-tbm
+CFLAGS  += -Wmissing-declarations
+CFLAGS  += -Wno-unused-result
+
+CFLAGS  += -DDEBUG_DEBUG 	# activate general debug (debug.c)
+CFLAGS  += -DDEBUG_POOL		# memory pools management
+
+VALGRIND := valgrind
+VALGRINDFLAGS := --leak-check=full --show-leak-kinds=all --track-origins=yes \
+	--sigill-diagnostics=yes --quiet --show-error-list=yes
+
+
+TIME    := \time -f "\ttime: %E real, %U user, %S sys\n\tcontext-switch:\t%c+%w, page-faults: %F+%R\n"
+export PATH := .:$(PATH)
+
+.PHONY: clean all compile assembly memcheck memcheck1 memcheck2 part1 part2 ccls bear org
+
+all: README.org ccls part1 part2
+
+memcheck: memcheck1 memcheck2
+
+memcheck1: aoc-c
+	@$(VALGRIND) $(VALGRINDFLAGS) aoc-c -p 1 < $(INPUT)
+
+memcheck2: aoc-c
+	@$(VALGRIND) $(VALGRINDFLAGS) aoc-c -p 2 < $(INPUT)
+	@#@valgrind -s --track-origins=yes aoc-c -p 2 < $(INPUT)
+
+compile: aoc-c
+
+cpp: aoc-c.i
+
+assembly: aoc-c.s
+
+part1: aoc-c
+	@$(TIME) aoc.bash -p 1 < $(INPUT) 2>&1
+	@$(TIME) aoc-c -p 1 < $(INPUT)
+
+part2: aoc-c
+	@$(TIME) aoc.bash -p 2 < $(INPUT) 2>&1
+	@$(TIME) aoc-c -p 2 < $(INPUT)
+
+ccls: $(CCLSFILE)
+
+clean:
+	@rm -f aoc-c core* vgcore* gmon.out aoc-c.s aoc-c.i README.html compile_commands.json
+
+aoc-c: aoc-c.c common.c
+	@echo compiling $<
+	$(CC) $(CFLAGS) $(LDFLAGS) -I $(INCDIR) $^ $(LDLIB) -o $@
+
+# generate pre-processed file (.i) and assembler (.s)
+%.i: %.c
+	@echo generating $@
+	@$(CC) -E $(CFLAGS) -I $(INCDIR) $< -o $@
+
+%.s: %.c
+	@echo generating $@
+	@$(CC) -S -fverbose-asm $(CFLAGS) -I $(INCDIR) $< -o $@
+
+# generate README.org from README.html (must cleanup !)
+org: README.org
+
+%.org: %.html
+	@echo generating $@. Cleanup before commit !
+	@pandoc $< -o $@
+
+# generate compile_commands.json
+$(CCLSFILE): aoc-c.c Makefile
+	$(BEAR) -- make clean compile
+
+bear: clean
+	@touch .ccls-root
+	@$(BEAR) -- make compile

2022/day03/README.org

@@ -0,0 +1,114 @@
+** --- Day 3: Rucksack Reorganization ---
+One Elf has the important job of loading all of the
+[[https://en.wikipedia.org/wiki/Rucksack][rucksacks]] with supplies for
+the jungle journey. Unfortunately, that Elf didn't quite follow the
+packing instructions, and so a few items now need to be rearranged.
+
+Each rucksack has two large /compartments/. All items of a given type
+are meant to go into exactly one of the two compartments. The Elf that
+did the packing failed to follow this rule for exactly one item type per
+rucksack.
+
+The Elves have made a list of all of the items currently in each
+rucksack (your puzzle input), but they need your help finding the
+errors. Every item type is identified by a single lowercase or uppercase
+letter (that is, =a= and =A= refer to different types of items).
+
+The list of items for each rucksack is given as characters all on a
+single line. A given rucksack always has the same number of items in
+each of its two compartments, so the first half of the characters
+represent items in the first compartment, while the second half of the
+characters represent items in the second compartment.
+
+For example, suppose you have the following list of contents from six
+rucksacks:
+
+#+begin_example
+vJrwpWtwJgWrhcsFMMfFFhFp
+jqHRNqRjqzjGDLGLrsFMfFZSrLrFZsSL
+PmmdzqPrVvPwwTWBwg
+wMqvLMZHhHMvwLHjbvcjnnSBnvTQFn
+ttgJtRGJQctTZtZT
+CrZsJsPPZsGzwwsLwLmpwMDw
+#+end_example
+
+- The first rucksack contains the items =vJrwpWtwJgWrhcsFMMfFFhFp=,
+  which means its first compartment contains the items =vJrwpWtwJgWr=,
+  while the second compartment contains the items =hcsFMMfFFhFp=. The
+  only item type that appears in both compartments is lowercase =p=.
+- The second rucksack's compartments contain =jqHRNqRjqzjGDLGL= and
+  =rsFMfFZSrLrFZsSL=. The only item type that appears in both
+  compartments is uppercase =L=.
+- The third rucksack's compartments contain =PmmdzqPrV= and =vPwwTWBwg=;
+  the only common item type is uppercase =P=.
+- The fourth rucksack's compartments only share item type =v=.
+- The fifth rucksack's compartments only share item type =t=.
+- The sixth rucksack's compartments only share item type =s=.
+
+To help prioritize item rearrangement, every item type can be converted
+to a /priority/:
+
+- Lowercase item types =a= through =z= have priorities 1 through 26.
+- Uppercase item types =A= through =Z= have priorities 27 through 52.
+
+In the above example, the priority of the item type that appears in both
+compartments of each rucksack is 16 (=p=), 38 (=L=), 42 (=P=), 22 (=v=),
+20 (=t=), and 19 (=s=); the sum of these is =157=.
+
+Find the item type that appears in both compartments of each rucksack.
+/What is the sum of the priorities of those item types?/
+
+Your puzzle answer was =7878=.
+
+** --- Part Two ---
+As you finish identifying the misplaced items, the Elves come to you
+with another issue.
+
+For safety, the Elves are divided into groups of three. Every Elf
+carries a badge that identifies their group. For efficiency, within each
+group of three Elves, the badge is the /only item type carried by all
+three Elves/. That is, if a group's badge is item type =B=, then all
+three Elves will have item type =B= somewhere in their rucksack, and at
+most two of the Elves will be carrying any other item type.
+
+The problem is that someone forgot to put this year's updated
+authenticity sticker on the badges. All of the badges need to be pulled
+out of the rucksacks so the new authenticity stickers can be attached.
+
+Additionally, nobody wrote down which item type corresponds to each
+group's badges. The only way to tell which item type is the right one is
+by finding the one item type that is /common between all three Elves/ in
+each group.
+
+Every set of three lines in your list corresponds to a single group, but
+each group can have a different badge item type. So, in the above
+example, the first group's rucksacks are the first three lines:
+
+#+begin_example
+vJrwpWtwJgWrhcsFMMfFFhFp
+jqHRNqRjqzjGDLGLrsFMfFZSrLrFZsSL
+PmmdzqPrVvPwwTWBwg
+#+end_example
+
+And the second group's rucksacks are the next three lines:
+
+#+begin_example
+wMqvLMZHhHMvwLHjbvcjnnSBnvTQFn
+ttgJtRGJQctTZtZT
+CrZsJsPPZsGzwwsLwLmpwMDw
+#+end_example
+
+In the first group, the only item type that appears in all three
+rucksacks is lowercase =r=; this must be their badges. In the second
+group, their badge item type must be =Z=.
+
+Priorities for these items must still be found to organize the sticker
+attachment efforts: here, they are 18 (=r=) for the first group and 52
+(=Z=) for the second group. The sum of these is =70=.
+
+Find the item type that corresponds to the badges of each three-Elf
+group. /What is the sum of the priorities of those item types?/
+
+Your puzzle answer was =2760=.
+
+Both parts of this puzzle are complete! They provide two gold stars: **

2022/day03/aoc-c.c

@@ -0,0 +1,97 @@
+/* aoc-c.c: Advent of Code 2022, day 3
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <string.h>
+
+#include "aoc.h"
+
+#define NCHARS ('Z' - 'A' + 1 + 'z' - 'a' + 1)
+
+/* convert item to map position, and vice versa */
+#define CHAR2POS(c) ((c) > 'Z'? (c) - 'a': (c) - 'A' + 26)
+#define POS2CHAR(p) ((p) < 26? (p) + 'a': (p) - 26 + 'A')
+
+/* set a map from char */
+#define SET_MAP(ex, c) ((ex)[CHAR2POS(c)] = 1)
+
+static void map_init(char *p)
+{
+    memset(p, 0, NCHARS);
+}
+
+static void map_populate(char *ex, char *p, int len)
+{
+    map_init(ex);
+    for (; len; --len)
+        SET_MAP(ex, p[len - 1]);
+}
+
+/* match map with items list. If dest is NULL, return first match,
+ * otherwise populate dest with matching chars.
+ */
+static int map_match(char *dest, char *map, char *items, int ilen)
+{
+    if (dest)
+        map_init(dest);
+
+    for (int i = 0; i < ilen; ++i) {
+        int pos = CHAR2POS(items[i]);
+        if (map[pos]) {                           /* already exists */
+            if (dest)
+                dest[pos] = 1;                    /* fill dest array */
+            else
+                return pos + 1;                   /* one match only: return prio */
+        }
+    }
+    return -1;                                    /* unused if dest != NULL */
+}
+
+static int parse(int part)
+{
+    size_t alloc = 0;
+    char *buf = NULL;
+    ssize_t buflen;
+    int line = 0, res = 0;
+    char map[2][NCHARS];
+
+    while ((buflen = getline(&buf, &alloc, stdin)) > 0) {
+        buf[--buflen] = 0;
+        if (part == 1) {
+            int half = buflen / 2;
+            map_populate(*map, buf, half);        /* populate and calculate */
+            res += map_match(NULL, *map, buf + half, half);
+            continue;
+        }
+        /* Part 2 here */
+        switch (++line % 3) {                     /* group lines by 3 */
+            case 1:                               /* line 1: populate *map */
+                map_populate(*map, buf, buflen);
+                break;
+            case 2:                               /* line 2: merge #1 into map[1] */
+                map_match(*(map + 1), *map, buf, buflen);
+                break;
+            case 0:                               /* line 3: final merge & calc */
+                res += map_match(NULL, *(map + 1), buf, buflen);
+                break;
+        }
+    }
+    free(buf);
+    return res;
+}
+
+int main(int ac, char **av)
+{
+    printf("%s: res=%d\n", *av, parse(parseargs(ac, av)));
+    exit(0);
+}

2022/day03/aoc.bash

@@ -0,0 +1,86 @@
+#!/usr/bin/env bash
+#
+# aoc.bash: Advent of Code 2022, day 3
+#
+# Copyright (C) 2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+
+. common.bash
+
+declare -a input
+
+# prio - get priority value for an item
+# $1: reference of variable for result
+# $2: string
+prio() {
+    local -n _val="$1"
+    local _char="${2:0:1}"
+
+    printf -v _val "%d" "'$_char"
+    if [[ $_char > "Z" ]]; then                   # a-z
+        ((_val += (1 - 97) ))
+    else                                          # A-Z
+        ((_val += (27 - 65) ))
+    fi
+}
+
+# common=chars - get common characters in two strings
+# $1: reference of variable for result
+# $2, $3: The two strings
+common_chars() {
+    local -n _res="$1"
+
+    _res="${2//[^$3]}"
+}
+
+parse() {
+    readarray -t input
+}
+
+part1() {
+    local line half1 half2 common
+    local -i half i prio
+    declare -ig res=0
+
+    for line in "${input[@]}"; do
+        (( half = ${#line} / 2 ))
+        half1="${line:0:half}"
+        half2="${line:half}"
+        common="${half1//[^${half2}]}"
+        prio prio "${common}"
+        (( res += prio ))
+    done
+}
+
+part2() {
+    local one two three common
+    local -i i prio
+    declare -ig res=0
+
+    for (( i = ${#input[@]} - 1; i > 1; i -= 3)); do
+        three=${input[i]}
+        two=${input[i - 1]}
+        one=${input[i - 2]}
+        common_chars common "$three" "$two"
+        common_chars common "$common" "$one"
+        prio prio "${common}"
+        (( res += prio ))
+    done
+}
+
+solve() {
+    if (($1 == 1)); then
+        part1
+    else
+        part2
+    fi
+}
+
+main "$@"
+exit 0

2022/day03/aoc.h

@@ -0,0 +1,17 @@
+/* aoc.c: Advent of Code 2022
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+#ifndef _AOC_H_
+#define _AOC_H_
+
+extern int parseargs(int ac, char**av);
+
+#endif  /* _AOC_H_ */

2022/day03/common.bash

@@ -0,0 +1,68 @@
+#!/usr/bin/env bash
+#
+# common.bash: Advent of Code 2022, common bash functions
+#
+# Copyright (C) 2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+
+# shellcheck disable=2034
+export cmdname=${0##*/}
+export debug=0
+export res
+export LANG=C
+
+shopt -s extglob
+set -o noglob
+
+usage() {
+    printf "usage: %s [-d DEBUG] [-p PART]\n" "$cmdname"
+    exit 1
+}
+
+checkargs() {
+    local part=1
+    while getopts p:d: todo; do
+        case "$todo" in
+            d)
+                if [[ "$OPTARG" =~ ^[[:digit:]+]$ ]]; then
+                    debug="$OPTARG"
+                else
+                    printf "%s: illegal [%s] debug level.\n" "$CMD" "$OPTARG"
+                    exit 1
+                fi
+                ;;
+            p)
+                if [[ "$OPTARG" =~ ^[12]$ ]]; then
+                    part="$OPTARG"
+                else
+                    printf "%s: illegal [%s] part.\n" "$CMD" "$OPTARG"
+                    exit 1
+                fi
+                ;;
+            *)
+                usage
+                ;;
+        esac
+    done
+    # Now check remaining argument (backup directory)
+    shift $((OPTIND - 1))
+
+    (( $# > 1 )) && usage
+    return "$part"
+}
+
+main() {
+    local -i part
+
+    checkargs "$@"
+    part=$?
+    parse "$part"
+    solve "$part"
+    printf "%s: res=%s\n" "$cmdname" "$res"
+}

2022/day03/common.c

@@ -0,0 +1,49 @@
+/* common.c: Advent of Code 2022, common functions
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <unistd.h>
+
+#include "aoc.h"
+#include "debug.h"
+
+static int usage(char *prg)
+{
+    fprintf(stderr, "Usage: %s [-d debug_level] [-p part] [-i input]\n", prg);
+    return 1;
+}
+
+int parseargs(int ac, char **av)
+{
+    int opt, part = 1;
+
+    while ((opt = getopt(ac, av, "d:p:")) != -1) {
+        switch (opt) {
+            case 'd':
+                debug_level_set(atoi(optarg));
+                break;
+            case 'p':                             /* 1 or 2 */
+                part = atoi(optarg);
+                if (part < 1 || part > 2)
+                    return usage(*av);
+                break;
+            case 'i':
+
+            default:
+                return usage(*av);
+        }
+    }
+    if (optind < ac)
+        return usage(*av);
+    return part;
+}

2022/day03/input/example.txt

@@ -0,0 +1,6 @@
+vJrwpWtwJgWrhcsFMMfFFhFp
+jqHRNqRjqzjGDLGLrsFMfFZSrLrFZsSL
+PmmdzqPrVvPwwTWBwg
+wMqvLMZHhHMvwLHjbvcjnnSBnvTQFn
+ttgJtRGJQctTZtZT
+CrZsJsPPZsGzwwsLwLmpwMDw

2022/day03/input/input.txt

@@ -0,0 +1,300 @@
+ZNNvFWHqLNPZHHqPTHHnTGBhrrpjvmwfMmpfpjBjwpmw
+sbdzQgzgssgbglRtmjlwhjBlfrSrMt
+zgsCRzJbsdRVQCDbcgLGWWLnZNGVLLZMNZnq
+tvHhRtZGMvMHvfsrBBCTRbwbccRc
+qznnlpzzDppWlDpQpCrcrwnBNwTZnBTZrn
+PdVZJJqVZdllDPFtMjMgLjGMHvSgMF
+csbhhVDDvzlVDcbccGGvfRjDHCjNLRHRCLfmnZfR
+dFrStSTTmrrrHVfV
+MMgQMMTMVTdgWtwTPwSgWSgGbbppJzlplvhBlPbzhlhbzG
+FDJSTtSGhpPFDmFTZDpTFPmCBBrHqsCBhgBlqqrqrlRrHH
+dQwMtfdzVwWfwctwnfnQCHllzRrsNzrrgNlCgqsr
+fLfQnVjfwQfMdfvfnVvWDvtJPFGDpvZGbZpmbSPP
+TzzCrJcDrTDdLDCJDvGNPCFqlZWlvNvWpq
+RRHfjsQBFsjgjBQsWqGpNvZQqQlPPQPN
+VnHBnRVssnnjsSfBwbMSrrbTwJTcwSDF
+HJCgHCCFFFVGJWTlbqDdlqTDDpgl
+cZccSmLrfZcrmmzSQftdpDtTHdbQTDMQ
+NZZccrrBwZRPNNzmcLSSjJhGhVWCnsFnHBjGChsJ
+qwwwJHTHqdFDtZBFPfFBZFzM
+gVRcLnnWVgggnnnQgVWWNZtZrBfLBzZzBrMPPrZvPv
+GQgQSVRtsVnNRGSCdpmwspmbmDpHmhwd
+bhNgNfgwpbLMhCZMGQBmDm
+FrcHrSllcqcFFMGLBDQlMDTGlT
+FVSddRSJRjLwbjJPJw
+wzhhrTwwTrSsdHQjjSHnBjQj
+gRDCmVgRgMvtMfVMRBBBhWCHQQHGJHZJQZ
+NtgVgttVbMNmvsNlpcrLhLTNPw
+MCgjsfnscgjjgnGgJHHqHDgdHbGr
+QSSmRFPpRtPFQLQRmPzvBzzzDWqrqWWHJGGNrJJbdtVWHJDV
+BdSFdLQzRFlSLmQplffwncfscChhcsMj
+GfVmfnmJVnNVFhnhGmbmhpHvqjrzHZBjfvrtBHHZrwBt
+ddWQldlMdWMlQsLWTLQgMNwBrvjrZjNrwzZjswHqrv
+QQdTRcgTRPDlMQlQPQdhcNNnbJmbGpVnGchFmm
+CjjZCCZfvWZRHHhRtwhvPN
+mrnqlqMqBlSSLnBTLBwmHPPWhPPHtFRPWzwt
+rBVTrrMMSMLQBrndGcddWQbbdZfCZJ
+LFtdjHjLjLqHqstLTjFLFqNMnMhhZdDDNMVbWdDDbhnZ
+CrBpBGnzrzmczcllrphCZZWJMDWRbbZNMDMR
+GwgvzpzvrcmBrnfHjTgqTsgHjF
+rMPPZcplCZlZPwtSwhtBwCQQzB
+FvDGffLqqmQFwmmhzt
+TjJjJfHHVDVnHVgZZlQppcVscP
+hVcqHwhgwwwjHjjGWbvrbBGrsWVWGn
+CttPRpMmPDTWbWltlLBnGl
+pZmDFMmPMfnZwqqwfcqJdHgz
+bSJWhWJCbGGWJPStWTgRQwzDjgQQjsDW
+nFBBVQVrVBrNFMFZVpBBZFZrDgdTldgsRsslsljsRzTRjzns
+rMcZcHcBQPvbbHGP
+mSfmwqfmzrfHwFfmrwvPHqPmMFRlMDDZBCVVRCVZVlZpMRRR
+TWjdTWhTsssLTGsJNWhTQddjRMDMtNNBSCDBllMMBVtDMVRZ
+QhWTQcdhjThsdGbTLGjWHmffnmHwnwHrwqmmfcwS
+LmrsMQnnpfmMLllvTvqvFFzvFHNN
+WGRFVWdwZWZvCbJzcvJNzw
+VjGhDtWGSFRGjVVSFdjjDPBfspPnnMBLPLrrpMMm
+qqqCCJjtqtqCtqLZspHWBdSrWWSzzbzHFWBldb
+GhwwcwPFVDcNFRRGwwzmlBrBWvllrvSzlrcd
+DGGhQNNDhTpZZqqLQFQQ
+QfZmgQQZCCMLfNrgprdNvvdrTg
+hhttsBmBDcFRBlJshJcRrnjnTvNqpddNNqvndp
+JtsGJGtGGJJJHDbctllhZHmMwMQSPVPzHSLMPZmV
+DScSjZcNBZqjDDcLLfFtPfCfjfPvfv
+pTmRlWhdMwTLGwCf
+mRdWCVVglWrCmVHVrVCmdrbSzNcBDBqBZDNHqssscNzqNc
+sPMHGFMsrPNCPnNS
+ffJzllbzpZBllttBtfglgBTbSCVCmmrNFmmbFNvCFLLb
+cpZqpfgZZJtJqJJJfWHWhHdHWHjcdRdFHD
+ZZPfppvzMrlNBFcvFB
+shJgstJwWLVJwcrFFVFrBVNNqFFB
+HwWJdLHWWLcQgssHwwSQSQtQzCnZZMpZCmdzZCzpPzpCPRCj
+QCpLRbsCCQQLbQzCBQDQBBfTTffWtTctJVRNVtnfwtWV
+GvlqqlGlmMrdsvrhmlcTvwJtwNwTvfJfcWTW
+lMhgqGhddjqFFCzBBpbsSQpD
+JJwGJwVQQwVSsSMhQMQgHfgfTtrrfVTNgNNfrt
+dFDWCDdFppvDFmWWWnJTPllHmHlgrqrgggtH
+DzFbWjdRpbdFCjjRbnFbQBGhhQBBJZwMhScwZwJz
+HttvHpHmpJWtHmFNvlvdMSVdPMtLVCCMMMfcfL
+GjgzhGSGSSdCcRMVjMdc
+QshbnghgnGDnqsFrNSJFrsNs
+wJpjMwzjzdVbzPPVpbCHnqGnBqnsBrNCwgrC
+ftTLLDTQtLTGTGtFrgHrvqgQnrvQsCHH
+fTcFFfLSfFFcGFllcFhPJPjWWJSjSWzMWPdS
+ZjNdmjVQVZmvNNZNNZHWZmWtsJnwTpJJswpWwGqJhJqGpp
+FcRRcDblDMLRcRMLFFMDGsJnqhwpqTTJGwnsfnlp
+LRBrcLbbgLFgBbFqDvdHQvCCjNzzzVrZdV
+BdbLWrgdvgWvVJgWnDfNhVnqhCCpDpcq
+tSQPSTSGPMmlMPtQQPJGtGQRCcnqqfnRhCcChDqnCfRScf
+jTssPsjMQMmszPjlTtsJdFBFrJzrbJdHZFHdWH
+vCccctvvTTtZcgLGcZTbssbMWnpMpmLWqnNjpfPPfPjMPp
+wwBBlRBBwDDVFRhFlRhdRRVWPnnpMpffmmffrpWqVNPm
+ddhddRzHlQHFJcGsCztTgbNzST
+fJctfpVWcnfRLfrRwP
+vmmnvDQDZTNTmGGTqTMTvMqwBdLjBvRzBRrRBRLjjBPzBB
+GMnmqSTFFQqttcbcJWgsSt
+rHNfmfRsmfRGfDNcRmcmMQlLCGSnQwwPPCSnzQlSCl
+bsJTBsVhFsVpqFWFgPCwnQwBZzwQzZLlzn
+qggTTqvqgqbbTTFqVqgWqvNmmMMRdffftNfMDMmscR
+rFWQFszrwjsjFWvshPTCmLZLSTLwSLlgSP
+BQbcqVHNVqVpVpmClJgJJHSmZLJm
+qBNNNVdDMGBpDcDWsvdQsFrFnjttfj
+qGhmttmzhtMvhbrLdSHbdSHRzb
+WCBgQJJpjCQlgdHZrfPRPSRbNg
+jBTTDjlnjnJDJTQCVntcwtwMSvqcGFDhcvsh
+ZTrnTqMWWWnfrddMGJPgPLlPbw
+VvmGRVpBpNNmvNvjVjtpNpCNLLLJHHBdgLPdwsdsbLlwwlwb
+GmCVSCRVGmpCRVvttmpDrQZfhnzhzqnDWnrZZTQq
+DQBZHHtWHzSvZvDQWchgqsqqhrrhhcqrcZ
+jdMfwlFfFlTfndwpjjwGnNrqhPTmPSPTPPhmgrPSrh
+jlGbwGMdlnJpGFGjpnFCSJzzDDtWHCBBQBvtVC
+RrbBWBRRWSRsBBVvsPHZDwSjjPdnHwtPtH
+fTgfzMmNJpmJgfllgpjVQtDDndVQpdnHVtPp
+gGmlNclTGmGFhLVcVrvLqrvc
+QcpCTVCZVcCwLcCVvHvvVsCcNzNNSbPRzsDRDSBlsNNzDRtb
+fggMfJqgrWFpmjWMggmrfMWNSbRSPBDbNtJRtPJzlStBbN
+gdnmpWGnZvdQCvdv
+tqqcLqqDDqNtDrqHrrPWlTlTWZTMzTFzQlMPSZ
+pfnpmmppmppRGjwbjmnjwspWbQQQTMWZbCTSZCSQlCllZF
+gmpVnGmmmpjDvVLBFqqvrH
+LqBvJHZvbHGBHrBtGGQTmSVprVzhpVPDPQzQ
+CRdRgwCfhTVDzSdQ
+fRCcjgSMjfNgMMLGbGZtvBbGHv
+HgvtDDzDpvwgvvqdHPZWdMssTTddSs
+rJFrGNFVQmNFVmRnWhhsrTbhwhZTrdTd
+VQGBBBVNQClpcBvBwD
+PWlSzZGmdmGmlGmhggBpvMjvMjFgPJ
+TtLRDtQQfTVcQQQRtBsJFFccFjWhJJFMBs
+HqVCNtWHCDwdnlGwGqSr
+RwdRJgCJRGGmdMbcGbdnTnTtttLLnptMtMtMqZ
+DWsWPFrPqVPPLVCB
+zQWWsslsQHFhDSszDSFQzJJJmvcgblRgmNvCJmvNgw
+tpmFrWTtRpRTtggsSlnQpsnnlSHPsn
+bZwZjNNZGLSrVsGndPPV
+NvrcjCfbvvLBDBWfWFgRRm
+WWFMgWmMhhwDcMMMDcmLWLtQwwsjbsQHvZHbRjZfsZzH
+PTCplTCdSJJCpvPGNSvsbsfHtbQZzdHjQtjjsj
+vNGJPpqJvJvqghgFgWFmLD
+RlRpLTZCjWRjRWwpRsjHjbSbqMqMvvnbnGMnGGqQCq
+gddfDNczmgPthNcDdgPVnbbzbnJrJJGSSVJJQS
+BmDmcDmcmhffdBHlRwjRLpwlWQ
+prQlfzlWRPzgQWzlMPMRppssHHsDsHjwnHHbWDwwbwjL
+vFBJJtZNShJvZFtdSqtmqjTDVHVGDHbwVHDVsDnThH
+vcjBZZdZqvCfpzRfcgRp
+cggpqgRlSpNsgNggbjjj
+ZZSSJVLVLFDZWNGjCWWbCjsF
+vZLvfZQQfQtJVJDQShLrLfMmnldmwqwTqqMcMTMTndrm
+bQBMtBPddtMFbJFhRGzMfzvnRGRSvWnW
+TmHTqlVHwVpQqjmwGvSgSpnLpzfWGWSn
+TTrDQCDrrTmDCCCVHHQZBdZFPdsNdFBtFDhtFB
+fjpQvNZcGhGGTtQS
+DVJzvbVmHbbtSTSTRStzTM
+VDvmqllmJfjWlnplNs
+ZmdHZJjvQLdRjpmLJrqqZBhhtCschPfBPcrDfPffCD
+MWWSMMwnwlSgzWFFgSwzVwzqcfDCfChCbbtssbfDChcD
+NMqFTwGqMwgwwgjHRdHRjdmQmQTm
+TTqWPCWRhTWqPNjPJMNtrlbJFttQwwrBrlbwlc
+GfpSDGZvpQffSHDgggDZrHctFmrHncnnwwbBtBrt
+SQGfLsSLZsqMTRNMPT
+HdBdnBZJTZBBmsfwwBlh
+MjCVjzwqWrfzplzW
+vVbqCjjRgjwMbnbGHJScScZHLL
+dwwwtCdznvDDFrMrrw
+GmWLQmgQmHgcdGcsTgTDqDbSfFWfMDMfbSNqvr
+QhTLmVQHLmdLTjGGVptRnZpZBZVRpPpP
+CzjFpzRHdtBFBCqNqSbJZWcQJTSbQjMTWZ
+wGwVLlGrdVGwDnwsgfMSZvJMbWJcWlvbbMSc
+rDfsgggrGnGngsPwdVLfDnmDtzzFNCPHtzCtFHpBRqhPztzR
+mrgWzBcDtVCcQcCCdscf
+LRJhjRjPZvqSRGhGjLgMCdHpMNwQCpMHpHMS
+GRvGJRJjqPZbvGGhRjnqLJWtgFgtzTzDrFnTWrlTlllW
+cbmcddlffvbTfvFflpZzsMVNznNVlnqnzqHMNM
+StWJBQRWLRWNPNMCswRVHC
+BJQBhSWhjSthJQGGWWggJDDDfbdbbfHbddbrFrddvFvv
+jFqvqvWZWDtBJrrlrq
+TzGcbHcrmVzMGNSmTcGDtBthJCNtsJDlBCghgP
+bTrnTccnLSrrTHbnwfLjfdvRRwZFdwfR
+drHVrdVDfsDbVsdVDbVqRwbZZwCRCCCJlJThwRgT
+jFPcFpBSvtNPzSFcjcQpcQjpThZCRltGRRRJhwCwGhwgwhRm
+SQSzPBjjPPSvLqqssdnqLZLMsM
+bQTWlWlvQclNwwWlCCLStCRSSjStpj
+zVZZDdBnBmgzVsjsLthSpshdCL
+DfBnrmBmgzHBfDHmnGrNFCwQvTPvqCTwqTFGbF
+srSWJnrbmlWlbhzsWszSvPGwvgDhcjdjjfvhjvGv
+BRRQFLtNfQNMpqpQHDjdDjDcZZcvwZZHPH
+NLCNCtRQfRttRFRCTqMBqQQrzrbzrlJmVVbsSWmVrTbSzJ
+RHLfLcSRTFSghLRHGbwZmMZddgJswZsbMm
+ptqjtCzzQztqCjDlBGpDpbMZdwmMbZsdwNmdJpbs
+tttzCVllDCtDQnQBVHGHWvWTLWcLSLHf
+FVlNnPqbGTHftghggJqf
+zLcZWZpWWrcrZLLZDWrwMcrhBFBttChBmBgptChhtFftmf
+LZZLrDrrDDMrcwrDwsWFzdTlnGQPQQVbdbnsvnvsVQ
+BbPNMJNbQvDbvPLwHflczlwwzf
+pZjWZGZjFGdgpnVgZhghdmcflrlswzzcstlrLwhtwc
+WZSdqFjqSqSWdGFjZpdMTTDNTvLCRRLLqRQMCN
+FqgFGtbgTvRwrLqhvw
+JCCWJWCdJMQNNsSWsMPQRDDLDSDLwTrrvnwfDvnD
+HdPJlBBHCCQdBMWdTtVbgHczGVGjmtzG
+PLlZDLZDsFCvbDQv
+HVcTmVmJqVzqczfzbjvvCFMRfCsWjMvR
+cqHzTqJTTTTzzmnmrctrBlLlvSlgLdZvSwSlpw
+SbMMNJjmgMnJdSSbjVFZVSQrlQfWVQVWZh
+PtqDqPGcLHzHpqLcRzRsfQFfZlfRfZfRFVsl
+cTDLcqGCzDTqzzDLDzqPTtJvbBJMnmvjbdlmJNvmdgNC
+tDJDlZVqJGbvHNQbNFFsFPmLns
+ppczpzpffGwfBNLGmn
+WShzgTTpWzhWztJJGJSvtvvtjq
+TbZFTFScnCZFQRTCqQdBjdJqjBqjjQDB
+rmmLpLLfzrlmslMBHvdRddNDDJDrqD
+MWwLPzmWfpsMmmlMPMWLwRTZTZnnTcVCcZFCwSnZ
+SqmClqHssNWCqPTcWcGhBTchVV
+ZnnnDflRpBVTTVhPBZ
+DpgfvnvMfCsqlMtSll
+ZzLMRZpLMwwppZqnQGvQgBSvlNVlBFFNFVrg
+HcqhTmhmdDTPFTJgTTFBSgJN
+mccPdDDHbssbtwZMqpbzCRGM
+TgqnTltgWqLRSRnlqddngFfrvHvrBTfCCFrFVTvVCf
+cwNJmPzQwNzczzNsJGhhHfhrfvVHGvtvVVfC
+jjtbtDswcmPWlbgRnRdMZL
+TmpTBBwvspTptRmsmTGLQDGRHGgVGLSQSMHQ
+ZlPWqjWrzjPqdrlzbrbrwfrWLHVMLnHDMVDQnLQfQfVngQLS
+zNwbrrFWbFJpmpmvvt
+RMQQMwHMMzcFsWsDrWfcpJpS
+LLhZmGVLhVlTZfWWfWpCrDsGSp
+VLVTnqjjZngtQRFjvzDM
+gmRBpjrpRvCfRCrBgvjHShnbnngbgSJnNsHMHS
+ZDPTwGWtqwHhSnbcMNJw
+DWGGqtVVqldWZzMzWmvjrjprLRFjRVvvff
+tCzVzsVtDFzssnSsgdqJdCNqJhmgmpqq
+PZccPGvQfRLMQwNdhpwhNh
+jLrcbRjPZBrcPdjRHFlWnVtBFslSWznW
+vvvbJbWrLvFWHzZzZRhB
+chtwTmCNlRRZzRPT
+hmcCssCswrMDGMSrsr
+LStGBsQLlllhzMzs
+dzVZDNWRDdZNDTZTPvWVhhphpMlfMccRmfnlMlRn
+VFvgTrNPdFWNNFNFTzTFFSjSQBCqrtQwSBGLLBGwGL
+qGJSJhWStdSfWvSvtGRRnzRDDggrgvnzsmRP
+lTTLpcljjGlLlLNBpjwFQDQmRnrRDPrPscRrDDng
+NCNjFlHNCTVjpwGqGSVbJddqZZJM
+MbWdgvHFlMvmzTzShvmm
+tqjqpLsNsrrsjstNLpQrGVhVBzrhVcfmchDcTPVVmc
+RqwjqjqsGjjGGQNjGpQZpqRFJgmMHwdbFWgnHMFdwmmCFW
+HHHLcCcVHjTHglsB
+wDSRwzzRpMSdNSPSwSpRbqvgBsdqlgTvBFBjgFvvgB
+RpbzPssDMWwNRbRNRPDsDhJthLQVGLJcctQCJQfQJCLm
+WsZgbNgZVCCWbVVVmgZbCCRPccGnzPBqJjzWJBJPzvBvGz
+SpfThHtrHFBPPzJvPntj
+QHDhhrhpTQpHhQHnfwnTCNlbZCCDLNllZlVsNCNl
+QtzJFRQLMRnZcZsfcphlPQ
+qSBbjmWSCNmVldSqqSqmjCSZshfwfrPPZZfcPVZfhgsgPg
+HqBbHqBGSlNBbltnLLHFJMtRvRTD
+tcGtDdMcttttHNBlMctldlwjwwqqCLCwDwZjFCZhmnwC
+VrJgvWWsPvRgVgrJQvfQfzgVzZwCbLZmnmwCwZqmnhjZbnLj
+sJpffsRWWRJVWWpHltSpnMHGcMTl
+zNqRbqSbfdcTLLfS
+ZVPzPnVvdLwLDPfF
+VWnzQCVWZVMzQRHgqgqrHGtGMp
+PbHpWfWPvRfbzWPFfRpPDtBwSHMwCBgDwBjDtMMM
+hTTdZQlcnTcmqVTdcddrDgBSwsjjBgqBtsCgMD
+hlldTmdJJmJdZvzfFfNJFJgRzR
+PJWvJBbWsfLQWsLvmCqHCcNLHqHLLcwDqV
+dQztrZrdwHhptqDH
+ZrMGjgMSrdzQGQRJPvGGbm
+RmjljZChlDZBCRRvlmNSLSqMNLzwLvppwQSQ
+sTnVnPrVGsGTPddJrfgQgqLgGpMNQtgNtNzg
+sbbTfTdcJPnHbsJfHsdcmDDmmqBZlClmjBRDCZ
+CJmHLmHFFCFbHsbJsJqvqhQqLDhQZvnQDZnn
+wGwppTjdWPdgFpGcScBqNnNqNhQlDqnDlZZW
+pGcgGgTpGjFdwpSFVgSdpPjrMCMffzJzRzztRfHCRsVmtbsz
+CgBClZfCflPflNZRvfQswwmwmwQsQhgppdhm
+qbzDGrjLLNLDHDqtJmmhhmQdhwpQhhbp
+NLGqVqjDjjGrMFrvFWPBRBZnCvfFnT
+tbrrHsgsVmmmbtgwVsQRqjJMmqMjQfJfLFLD
+ZvlBGzdvjGfRFJQJ
+dBppnnBBhdzZncBPlznpnNdWHSsbWthbSCgHrVfgSSwVgr
+VRvMtRVFHQLvMRQFQtBctrthshTTgCmhTrgWhWZsZZ
+lzJlGBSPPhzjgZsTCr
+wJlpJPfDSpwBnddqJDdpPpcvMFHFMvNbvnNMFHHRVVbR
+CPShbbdlGCdQqlRPGPdlDWDFzjtFjggCDJgWczfF
+mrHrTrrBMBsmNsrwsBpnfpggDDcjjDDpjzFJzzjtJz
+BvsNvBLHrrrNvwBTNNsNGbdQhlPGGfqhhRGqLGdl
+PSSlPtlStGhPNMtwPMPJzDddnbnDNTDDnJqjbz
+FFVHRwVLvFvVrVHrZcLmRHggjDmdDnDnznnznzQjzdmJddbn
+WrvgRgcRcRrrcRvgcVrHVrwCCSfsCsGsllhMSSSSMttlSCpG
+hBPJqVZTqqPSlGlfddfddZvl
+JWWMJCpnMrmztzdjnzld
+RbWsrwMrpbRspbWgpwhLJPccNVqLLPSVgVPV
+hcTrWqcfhwGfWrWMjHjGvDHPmJMDzF
+ZtlsnZZtLBSbSssnbndjDJJFHFHJPHPsHMTHHM
+ntRZtSbtZgZStTqchwQfRwNpcq
+GfLqrsqQGgPgjjQGVcNvTpTpNFcWPvPPpT
+bRnRLnMZFdCMcpvT
+RnRhzRlmlhhHhhmhRsqLrfzrGVSrGBSGrL
+fbMffwdZsncrGcfG
+qDBjSSLqhLBSmDbjqNhqTLjCGrCHGrvcGWcpWcrGWnCrpm
+STLDqbhTLqNTNSRhlwZlJlRQFFRwMdPQ
+TVVGNFggcjPPJzwvQlRRwRvSlcSc
+frsBbWhtSRzSLfRf
+qDCqddbsWrqzhsdNmdJNJHjTggFFVV
+NTWTDrSdFTLtPTGf
+lZqjHlVRvRltLtRWFMtFLL
+qvjWzzvVbZpjqllggscdchwDrCphwsdhrD

2022/day04/Makefile

@@ -0,0 +1,111 @@
+# AOC daily Makefile - GNU make only.
+#
+# Copyright (C) 2021-2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+#
+
+INPUT   := input/input.txt
+SHELL   := /bin/bash
+
+CC      := gcc
+BEAR    := bear
+CCLSFILE:= compile_commands.json
+
+LIB     := aoc_$(shell uname -m)
+INCDIR  := ../include
+LIBDIR  := ../lib
+LDFLAGS := -L$(LIBDIR)
+#LDLIB   := -l$(LIB) -lm
+LDLIB   := -l$(LIB)
+
+export LD_LIBRARY_PATH = $(LIBDIR)
+
+CFLAGS  += -std=gnu11
+CFLAGS  += -O2
+CFLAGS  += -g
+# for gprof
+# CFLAGS += -pg
+CFLAGS  += -Wall
+CFLAGS  += -Wextra
+CFLAGS  += -march=native
+# Next one may be useful for valgrind (some invalid instructions)
+# CFLAGS += -mno-tbm
+CFLAGS  += -Wmissing-declarations
+CFLAGS  += -Wno-unused-result
+
+CFLAGS  += -DDEBUG_DEBUG 	# activate general debug (debug.c)
+CFLAGS  += -DDEBUG_POOL		# memory pools management
+
+VALGRIND := valgrind
+VALGRINDFLAGS := --leak-check=full --show-leak-kinds=all --track-origins=yes \
+	--sigill-diagnostics=yes --quiet --show-error-list=yes
+
+
+TIME    := \time -f "\ttime: %E real, %U user, %S sys\n\tcontext-switch:\t%c+%w, page-faults: %F+%R\n"
+export PATH := .:$(PATH)
+
+.PHONY: clean all compile assembly memcheck memcheck1 memcheck2 part1 part2 ccls bear org
+
+all: README.org ccls part1 part2
+
+memcheck: memcheck1 memcheck2
+
+memcheck1: aoc-c
+	@$(VALGRIND) $(VALGRINDFLAGS) aoc-c -p 1 < $(INPUT)
+
+memcheck2: aoc-c
+	@$(VALGRIND) $(VALGRINDFLAGS) aoc-c -p 2 < $(INPUT)
+	@#@valgrind -s --track-origins=yes aoc-c -p 2 < $(INPUT)
+
+compile: aoc-c
+
+cpp: aoc-c.i
+
+assembly: aoc-c.s
+
+part1: aoc-c
+	@$(TIME) aoc.bash -p 1 < $(INPUT) 2>&1
+	@$(TIME) aoc-c -p 1 < $(INPUT)
+
+part2: aoc-c
+	@$(TIME) aoc.bash -p 2 < $(INPUT) 2>&1
+	@$(TIME) aoc-c -p 2 < $(INPUT)
+
+ccls: $(CCLSFILE)
+
+clean:
+	@rm -f aoc-c core* vgcore* gmon.out aoc-c.s aoc-c.i README.html compile_commands.json
+
+aoc-c: aoc-c.c common.c
+	@echo compiling $<
+	$(CC) $(CFLAGS) $(LDFLAGS) -I $(INCDIR) $^ $(LDLIB) -o $@
+
+# generate pre-processed file (.i) and assembler (.s)
+%.i: %.c
+	@echo generating $@
+	@$(CC) -E $(CFLAGS) -I $(INCDIR) $< -o $@
+
+%.s: %.c
+	@echo generating $@
+	@$(CC) -S -fverbose-asm $(CFLAGS) -I $(INCDIR) $< -o $@
+
+# generate README.org from README.html (must cleanup !)
+org: README.org
+
+%.org: %.html
+	@echo generating $@. Cleanup before commit !
+	@pandoc $< -o $@
+
+# generate compile_commands.json
+$(CCLSFILE): aoc-c.c Makefile
+	$(BEAR) -- make clean compile
+
+bear: clean
+	@touch .ccls-root
+	@$(BEAR) -- make compile

2022/day04/README.org

@@ -0,0 +1,90 @@
+** --- Day 4: Camp Cleanup ---
+Space needs to be cleared before the last supplies can be unloaded from
+the ships, and so several Elves have been assigned the job of cleaning
+up sections of the camp. Every section has a unique /ID number/, and
+each Elf is assigned a range of section IDs.
+
+However, as some of the Elves compare their section assignments with
+each other, they've noticed that many of the assignments /overlap/. To
+try to quickly find overlaps and reduce duplicated effort, the Elves
+pair up and make a /big list of the section assignments for each pair/
+(your puzzle input).
+
+For example, consider the following list of section assignment pairs:
+
+#+begin_example
+2-4,6-8
+2-3,4-5
+5-7,7-9
+2-8,3-7
+6-6,4-6
+2-6,4-8
+#+end_example
+
+For the first few pairs, this list means:
+
+- Within the first pair of Elves, the first Elf was assigned sections
+  =2-4= (sections =2=, =3=, and =4=), while the second Elf was assigned
+  sections =6-8= (sections =6=, =7=, =8=).
+- The Elves in the second pair were each assigned two sections.
+- The Elves in the third pair were each assigned three sections: one got
+  sections =5=, =6=, and =7=, while the other also got =7=, plus =8= and
+  =9=.
+
+This example list uses single-digit section IDs to make it easier to
+draw; your actual list might contain larger numbers. Visually, these
+pairs of section assignments look like this:
+
+#+begin_example
+.234.....  2-4
+.....678.  6-8
+
+.23......  2-3
+...45....  4-5
+
+....567..  5-7
+......789  7-9
+
+.2345678.  2-8
+..34567..  3-7
+
+.....6...  6-6
+...456...  4-6
+
+.23456...  2-6
+...45678.  4-8
+#+end_example
+
+Some of the pairs have noticed that one of their assignments /fully
+contains/ the other. For example, =2-8= fully contains =3-7=, and =6-6=
+is fully contained by =4-6=. In pairs where one assignment fully
+contains the other, one Elf in the pair would be exclusively cleaning
+sections their partner will already be cleaning, so these seem like the
+most in need of reconsideration. In this example, there are =2= such
+pairs.
+
+/In how many assignment pairs does one range fully contain the other?/
+
+Your puzzle answer was =444=.
+
+** --- Part Two ---
+It seems like there is still quite a bit of duplicate work planned.
+Instead, the Elves would like to know the number of pairs that /overlap
+at all/.
+
+In the above example, the first two pairs (=2-4,6-8= and =2-3,4-5=)
+don't overlap, while the remaining four pairs (=5-7,7-9=, =2-8,3-7=,
+=6-6,4-6=, and =2-6,4-8=) do overlap:
+
+- =5-7,7-9= overlaps in a single section, =7=.
+- =2-8,3-7= overlaps all of the sections =3= through =7=.
+- =6-6,4-6= overlaps in a single section, =6=.
+- =2-6,4-8= overlaps in sections =4=, =5=, and =6=.
+
+So, in this example, the number of overlapping assignment pairs is =4=.
+
+/In how many assignment pairs do the ranges overlap?/
+
+Your puzzle answer was =801=.
+
+Both parts of this puzzle are complete! They provide two gold stars: **

2022/day04/aoc-c.c

@@ -0,0 +1,43 @@
+/* aoc-c.c: Advent of Code 2022, day 4
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <string.h>
+
+#include "aoc.h"
+
+static int parse(int part)
+{
+    int res = 0, val[4];
+
+    while (scanf("%d-%d,%d-%d", val, val+1, val+2, val+3) == 4) {
+        if (part == 1) {
+            if ( (val[0] >= val[2] && val[1] <= val[3] ) ||
+                 (val[0] <= val[2] && val[1] >= val[3] ) ) {
+                res++;
+            }
+        } else {
+            if ( (val[0] >= val[2] && val[0] <= val[3] ) ||
+                 (val[0] <= val[2] && val[1] >= val[2] ) ) {
+                res++;
+            }
+        }
+    }
+    return res;
+}
+
+int main(int ac, char **av)
+{
+    printf("%s: res=%d\n", *av, parse(parseargs(ac, av)));
+    exit(0);
+}

2022/day04/aoc.bash

@@ -0,0 +1,37 @@
+#!/usr/bin/env bash
+#
+# aoc.bash: Advent of Code 2022, day 4
+#
+# Copyright (C) 2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+
+. common.bash
+
+parse() {
+    local -i _part="$1"
+    local -a _arr
+    declare -ig res=0
+
+    while IFS=-, read -ra _arr; do
+        # shellcheck disable=2068
+        set -- ${_arr[@]}
+        if (( _part == 1 )); then
+            (( ( ($1 >= $3 && $2 <= $4) || ($1 <= $3 && $2 >= $4) ) && res++ ))
+        else
+            (( ( ($1 >= $3 && $1 <= $4) || ($1 <= $3 && $2 >= $3) ) && res++ ))
+        fi
+    done
+}
+
+solve() {
+    :
+}
+
+main "$@"
+exit 0

2022/day04/aoc.h

@@ -0,0 +1,17 @@
+/* aoc.c: Advent of Code 2022
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+#ifndef _AOC_H_
+#define _AOC_H_
+
+extern int parseargs(int ac, char**av);
+
+#endif  /* _AOC_H_ */

2022/day04/common.bash

@@ -0,0 +1,68 @@
+#!/usr/bin/env bash
+#
+# common.bash: Advent of Code 2022, common bash functions
+#
+# Copyright (C) 2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+
+# shellcheck disable=2034
+export cmdname=${0##*/}
+export debug=0
+export res
+export LANG=C
+
+shopt -s extglob
+set -o noglob
+
+usage() {
+    printf "usage: %s [-d DEBUG] [-p PART]\n" "$cmdname"
+    exit 1
+}
+
+checkargs() {
+    local part=1
+    while getopts p:d: todo; do
+        case "$todo" in
+            d)
+                if [[ "$OPTARG" =~ ^[[:digit:]+]$ ]]; then
+                    debug="$OPTARG"
+                else
+                    printf "%s: illegal [%s] debug level.\n" "$CMD" "$OPTARG"
+                    exit 1
+                fi
+                ;;
+            p)
+                if [[ "$OPTARG" =~ ^[12]$ ]]; then
+                    part="$OPTARG"
+                else
+                    printf "%s: illegal [%s] part.\n" "$CMD" "$OPTARG"
+                    exit 1
+                fi
+                ;;
+            *)
+                usage
+                ;;
+        esac
+    done
+    # Now check remaining argument (backup directory)
+    shift $((OPTIND - 1))
+
+    (( $# > 1 )) && usage
+    return "$part"
+}
+
+main() {
+    local -i part
+
+    checkargs "$@"
+    part=$?
+    parse "$part"
+    solve "$part"
+    printf "%s: res=%s\n" "$cmdname" "$res"
+}

2022/day04/common.c

@@ -0,0 +1,49 @@
+/* common.c: Advent of Code 2022, common functions
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <unistd.h>
+
+#include "aoc.h"
+#include "debug.h"
+
+static int usage(char *prg)
+{
+    fprintf(stderr, "Usage: %s [-d debug_level] [-p part] [-i input]\n", prg);
+    return 1;
+}
+
+int parseargs(int ac, char **av)
+{
+    int opt, part = 1;
+
+    while ((opt = getopt(ac, av, "d:p:")) != -1) {
+        switch (opt) {
+            case 'd':
+                debug_level_set(atoi(optarg));
+                break;
+            case 'p':                             /* 1 or 2 */
+                part = atoi(optarg);
+                if (part < 1 || part > 2)
+                    return usage(*av);
+                break;
+            case 'i':
+
+            default:
+                return usage(*av);
+        }
+    }
+    if (optind < ac)
+        return usage(*av);
+    return part;
+}

2022/day04/input/example.txt

@@ -0,0 +1,6 @@
+2-4,6-8
+2-3,4-5
+5-7,7-9
+2-8,3-7
+6-6,4-6
+2-6,4-8

2022/day05/Makefile

@@ -0,0 +1,111 @@
+# AOC daily Makefile - GNU make only.
+#
+# Copyright (C) 2021-2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+#
+
+INPUT   := input/input.txt
+SHELL   := /bin/bash
+
+CC      := gcc
+BEAR    := bear
+CCLSFILE:= compile_commands.json
+
+LIB     := aoc_$(shell uname -m)
+INCDIR  := ../include
+LIBDIR  := ../lib
+LDFLAGS := -L$(LIBDIR)
+#LDLIB   := -l$(LIB) -lm
+LDLIB   := -l$(LIB)
+
+export LD_LIBRARY_PATH = $(LIBDIR)
+
+CFLAGS  += -std=gnu11
+CFLAGS  += -O2
+CFLAGS  += -g
+# for gprof
+# CFLAGS += -pg
+CFLAGS  += -Wall
+CFLAGS  += -Wextra
+CFLAGS  += -march=native
+# Next one may be useful for valgrind (some invalid instructions)
+# CFLAGS += -mno-tbm
+CFLAGS  += -Wmissing-declarations
+CFLAGS  += -Wno-unused-result
+
+CFLAGS  += -DDEBUG_DEBUG 	# activate general debug (debug.c)
+CFLAGS  += -DDEBUG_POOL		# memory pools management
+
+VALGRIND := valgrind
+VALGRINDFLAGS := --leak-check=full --show-leak-kinds=all --track-origins=yes \
+	--sigill-diagnostics=yes --quiet --show-error-list=yes
+
+
+TIME    := \time -f "\ttime: %E real, %U user, %S sys\n\tcontext-switch:\t%c+%w, page-faults: %F+%R\n"
+export PATH := .:$(PATH)
+
+.PHONY: clean all compile assembly memcheck memcheck1 memcheck2 part1 part2 ccls bear org
+
+all: README.org ccls part1 part2
+
+memcheck: memcheck1 memcheck2
+
+memcheck1: aoc-c
+	@$(VALGRIND) $(VALGRINDFLAGS) aoc-c -p 1 < $(INPUT)
+
+memcheck2: aoc-c
+	@$(VALGRIND) $(VALGRINDFLAGS) aoc-c -p 2 < $(INPUT)
+	@#@valgrind -s --track-origins=yes aoc-c -p 2 < $(INPUT)
+
+compile: aoc-c
+
+cpp: aoc-c.i
+
+assembly: aoc-c.s
+
+part1: aoc-c
+	@$(TIME) aoc.bash -p 1 < $(INPUT) 2>&1
+	@$(TIME) aoc-c -p 1 < $(INPUT)
+
+part2: aoc-c
+	@$(TIME) aoc.bash -p 2 < $(INPUT) 2>&1
+	@$(TIME) aoc-c -p 2 < $(INPUT)
+
+ccls: $(CCLSFILE)
+
+clean:
+	@rm -f aoc-c core* vgcore* gmon.out aoc-c.s aoc-c.i README.html compile_commands.json
+
+aoc-c: aoc-c.c common.c
+	@echo compiling $<
+	$(CC) $(CFLAGS) $(LDFLAGS) -I $(INCDIR) $^ $(LDLIB) -o $@
+
+# generate pre-processed file (.i) and assembler (.s)
+%.i: %.c
+	@echo generating $@
+	@$(CC) -E $(CFLAGS) -I $(INCDIR) $< -o $@
+
+%.s: %.c
+	@echo generating $@
+	@$(CC) -S -fverbose-asm $(CFLAGS) -I $(INCDIR) $< -o $@
+
+# generate README.org from README.html (must cleanup !)
+org: README.org
+
+%.org: %.html
+	@echo generating $@. Cleanup before commit !
+	@pandoc $< -o $@
+
+# generate compile_commands.json
+$(CCLSFILE): aoc-c.c Makefile
+	$(BEAR) -- make clean compile
+
+bear: clean
+	@touch .ccls-root
+	@$(BEAR) -- make compile

2022/day05/README.org

@@ -0,0 +1,169 @@
+** --- Day 5: Supply Stacks ---
+The expedition can depart as soon as the final supplies have been
+unloaded from the ships. Supplies are stored in stacks of marked
+/crates/, but because the needed supplies are buried under many other
+crates, the crates need to be rearranged.
+
+The ship has a /giant cargo crane/ capable of moving crates between
+stacks. To ensure none of the crates get crushed or fall over, the crane
+operator will rearrange them in a series of carefully-planned steps.
+After the crates are rearranged, the desired crates will be at the top
+of each stack.
+
+The Elves don't want to interrupt the crane operator during this
+delicate procedure, but they forgot to ask her /which/ crate will end up
+where, and they want to be ready to unload them as soon as possible so
+they can embark.
+
+They do, however, have a drawing of the starting stacks of crates /and/
+the rearrangement procedure (your puzzle input). For example:
+
+#+begin_example
+    [D]
+[N] [C]
+[Z] [M] [P]
+ 1   2   3
+
+move 1 from 2 to 1
+move 3 from 1 to 3
+move 2 from 2 to 1
+move 1 from 1 to 2
+#+end_example
+
+In this example, there are three stacks of crates. Stack 1 contains two
+crates: crate =Z= is on the bottom, and crate =N= is on top. Stack 2
+contains three crates; from bottom to top, they are crates =M=, =C=, and
+=D=. Finally, stack 3 contains a single crate, =P=.
+
+Then, the rearrangement procedure is given. In each step of the
+procedure, a quantity of crates is moved from one stack to a different
+stack. In the first step of the above rearrangement procedure, one crate
+is moved from stack 2 to stack 1, resulting in this configuration:
+
+#+begin_example
+[D]
+[N] [C]
+[Z] [M] [P]
+ 1   2   3
+#+end_example
+
+In the second step, three crates are moved from stack 1 to stack 3.
+Crates are moved /one at a time/, so the first crate to be moved (=D=)
+ends up below the second and third crates:
+
+#+begin_example
+        [Z]
+        [N]
+    [C] [D]
+    [M] [P]
+ 1   2   3
+#+end_example
+
+Then, both crates are moved from stack 2 to stack 1. Again, because
+crates are moved /one at a time/, crate =C= ends up below crate =M=:
+
+#+begin_example
+        [Z]
+        [N]
+[M]     [D]
+[C]     [P]
+ 1   2   3
+#+end_example
+
+Finally, one crate is moved from stack 1 to stack 2:
+
+#+begin_example
+        [Z]
+        [N]
+        [D]
+[C] [M] [P]
+ 1   2   3
+#+end_example
+
+The Elves just need to know /which crate will end up on top of each
+stack/; in this example, the top crates are =C= in stack 1, =M= in stack
+2, and =Z= in stack 3, so you should combine these together and give the
+Elves the message =CMZ=.
+
+/After the rearrangement procedure completes, what crate ends up on top
+of each stack?/
+
+Your puzzle answer was =VQZNJMWTR=.
+
+** --- Part Two ---
+As you watch the crane operator expertly rearrange the crates, you
+notice the process isn't following your prediction.
+
+Some mud was covering the writing on the side of the crane, and you
+quickly wipe it away. The crane isn't a CrateMover 9000 - it's a
+/CrateMover 9001/.
+
+The CrateMover 9001 is notable for many new and exciting features: air
+conditioning, leather seats, an extra cup holder, and /the ability to
+pick up and move multiple crates at once/.
+
+Again considering the example above, the crates begin in the same
+configuration:
+
+#+begin_example
+    [D]
+[N] [C]
+[Z] [M] [P]
+ 1   2   3
+#+end_example
+
+Moving a single crate from stack 2 to stack 1 behaves the same as
+before:
+
+#+begin_example
+[D]
+[N] [C]
+[Z] [M] [P]
+ 1   2   3
+#+end_example
+
+However, the action of moving three crates from stack 1 to stack 3 means
+that those three moved crates /stay in the same order/, resulting in
+this new configuration:
+
+#+begin_example
+        [D]
+        [N]
+    [C] [Z]
+    [M] [P]
+ 1   2   3
+#+end_example
+
+Next, as both crates are moved from stack 2 to stack 1, they /retain
+their order/ as well:
+
+#+begin_example
+        [D]
+        [N]
+[C]     [Z]
+[M]     [P]
+ 1   2   3
+#+end_example
+
+Finally, a single crate is still moved from stack 1 to stack 2, but now
+it's crate =C= that gets moved:
+
+#+begin_example
+        [D]
+        [N]
+        [Z]
+[M] [C] [P]
+ 1   2   3
+#+end_example
+
+In this example, the CrateMover 9001 has put the crates in a totally
+different order: =MCD=.
+
+Before the rearrangement process finishes, update your simulation so
+that the Elves know where they should stand to be ready to unload the
+final supplies. /After the rearrangement procedure completes, what crate
+ends up on top of each stack?/
+
+Your puzzle answer was =NLCDCLVMQ=.
+
+Both parts of this puzzle are complete! They provide two gold stars: **

2022/day05/aoc-c.c

@@ -0,0 +1,115 @@
+/* aoc-c.c: Advent of Code 2022, day 5
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <string.h>
+
+#include "br.h"
+#include "list.h"
+#include "pool.h"
+#include "aoc.h"
+
+#define MAXSTACKS 128
+
+typedef struct crate {
+    int code;
+    struct list_head list;
+} crate_t;
+
+static pool_t *pool_crates;
+
+static void move_stack(struct list_head *stacks, int from, int to, int nb)
+{
+    for (int i = 0; i < nb; ++i)
+        /* Attention !! we should test if &stacks[from - 1] is not empty here */
+        list_move(stacks[from - 1].next, &stacks[to - 1]);
+}
+
+static void move_bulk(struct list_head *stacks, int from, int to, int nb)
+{
+    struct list_head *tail;
+    LIST_HEAD(bulk);
+
+    int count = 1;
+    list_for_each(tail, &stacks[from - 1])
+        if (count++ == nb)
+            break;
+    list_cut_position(&bulk, &stacks[from - 1], tail);
+    list_splice(&bulk, &stacks[to - 1]);
+}
+
+static void parse(struct list_head *stacks, int *nstacks, int part)
+{
+    size_t alloc = 0;
+    char *buf = NULL;
+    ssize_t buflen;
+    int state = 0;
+
+    while ((buflen = getline(&buf, &alloc, stdin)) > 0) {
+        buf[--buflen] = 0;
+
+        if (!buflen || buf[1] == '1') {
+            state = 1;
+            continue;
+        }
+        if (!state) {                             /* stacks */
+            int stack = 0, pos, code;
+
+            for(pos = 1; pos < buflen; pos += 4, stack++) {
+                if ((code = buf[pos]) != ' ') {
+                    crate_t *new = pool_get(pool_crates);
+                    new->code = code;
+                    list_add_tail(&new->list, stacks + stack);
+                    if (stack == *nstacks)
+                        ++*nstacks;
+                }
+            }
+        } else {                                  /* moves */
+            int nb, from, to;
+            if ((sscanf(buf, "%*s%d%*s%d%*s%d", &nb, &from, &to)) == 3) {
+                if (part == 1)
+                    move_stack(stacks, from, to, nb);
+                else
+                    move_bulk(stacks, from, to, nb);
+            }
+        }
+    }
+}
+
+static char *build_res(struct list_head *stacks, int nstacks, char *res)
+{
+    int i;
+    for (i = 0; i < nstacks; ++ i) {
+        crate_t *cur = list_first_entry(&stacks[i], crate_t, list);
+        res[i] = cur->code;
+    }
+    res[i] = 0;
+    return res;
+}
+
+int main(int ac, char **av)
+{
+    char res[MAXSTACKS + 1];
+    int part = parseargs(ac, av);
+    struct list_head stacks[MAXSTACKS];
+    int nstacks = 0;
+
+    for (ulong ul = 0; ul < ARRAY_SIZE(stacks); ++ul)
+        INIT_LIST_HEAD(&stacks[ul]);
+    pool_crates = pool_create("crates", 64, sizeof (crate_t));
+
+    parse(stacks, &nstacks, part);
+    printf("%s: res=%s\n", *av, build_res(stacks, nstacks, res));
+    pool_destroy(pool_crates);
+    exit(0);
+}

2022/day05/aoc.bash

@@ -0,0 +1,62 @@
+#!/usr/bin/env bash
+#
+# aoc.bash: Advent of Code 2022, day 5
+#
+# Copyright (C) 2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+
+. common.bash
+
+declare -a stacks=() rules=()
+
+parse() {
+    local -i _queue _state=1
+    local _input
+    local -a _parse
+
+    while IFS= read -r _input; do
+        if [[ -z ${_input} || ${_input:1:1} == "1" ]]; then
+            _state=2
+            continue
+        fi
+        if (( _state == 1 )); then                # stacks description
+            for (( i = 0, _queue = 0; i < ${#_input}; i += 4, _queue++ )); do
+                sub=${_input:i:4}
+                [[ $sub == " "* ]] || stacks[$_queue]+="${sub:1:1}"
+            done
+        else                                      # moves description
+            rules+=( "${_input//[a-z]/}" )
+        fi
+    done
+}
+
+solve() {
+    local -i _part="$1" _i=0 _j=0 _nb _from _to
+    local -a _rule
+
+    for ((; _i < ${#rules[@]}; ++_i )); do
+        read -ra _rule <<< "${rules[$_i]}"
+        (( _nb = _rule[0], _from = _rule[1] - 1, _to = _rule[2] - 1 ))
+        if ((_part == 1)); then
+            # move elements one by one
+            for ((_j = 0; _j < _nb; ++_j)); do
+                stacks[$_to]="${stacks[$_from]:0:1}${stacks[$_to]}"
+                stacks[$_from]=${stacks[$_from]:1}
+            done
+        else
+            # move elements by block
+            stacks[$_to]="${stacks[$_from]:0:_nb}${stacks[$_to]}"
+            stacks[$_from]=${stacks[$_from]:_nb}
+        fi
+    done
+    printf -v res "%c" "${stacks[@]}"
+}
+
+main "$@"
+exit 0

2022/day05/aoc.h

@@ -0,0 +1,17 @@
+/* aoc.c: Advent of Code 2022
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+#ifndef _AOC_H_
+#define _AOC_H_
+
+extern int parseargs(int ac, char**av);
+
+#endif  /* _AOC_H_ */

2022/day05/common.bash

@@ -0,0 +1,68 @@
+#!/usr/bin/env bash
+#
+# common.bash: Advent of Code 2022, common bash functions
+#
+# Copyright (C) 2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+
+# shellcheck disable=2034
+export cmdname=${0##*/}
+export debug=0
+export res
+export LANG=C
+
+shopt -s extglob
+set -o noglob
+
+usage() {
+    printf "usage: %s [-d DEBUG] [-p PART]\n" "$cmdname"
+    exit 1
+}
+
+checkargs() {
+    local part=1
+    while getopts p:d: todo; do
+        case "$todo" in
+            d)
+                if [[ "$OPTARG" =~ ^[[:digit:]+]$ ]]; then
+                    debug="$OPTARG"
+                else
+                    printf "%s: illegal [%s] debug level.\n" "$CMD" "$OPTARG"
+                    exit 1
+                fi
+                ;;
+            p)
+                if [[ "$OPTARG" =~ ^[12]$ ]]; then
+                    part="$OPTARG"
+                else
+                    printf "%s: illegal [%s] part.\n" "$CMD" "$OPTARG"
+                    exit 1
+                fi
+                ;;
+            *)
+                usage
+                ;;
+        esac
+    done
+    # Now check remaining argument (backup directory)
+    shift $((OPTIND - 1))
+
+    (( $# > 1 )) && usage
+    return "$part"
+}
+
+main() {
+    local -i part
+
+    checkargs "$@"
+    part=$?
+    parse "$part"
+    solve "$part"
+    printf "%s: res=%s\n" "$cmdname" "$res"
+}

2022/day05/common.c

@@ -0,0 +1,49 @@
+/* common.c: Advent of Code 2022, common functions
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <unistd.h>
+
+#include "aoc.h"
+#include "debug.h"
+
+static int usage(char *prg)
+{
+    fprintf(stderr, "Usage: %s [-d debug_level] [-p part] [-i input]\n", prg);
+    return 1;
+}
+
+int parseargs(int ac, char **av)
+{
+    int opt, part = 1;
+
+    while ((opt = getopt(ac, av, "d:p:")) != -1) {
+        switch (opt) {
+            case 'd':
+                debug_level_set(atoi(optarg));
+                break;
+            case 'p':                             /* 1 or 2 */
+                part = atoi(optarg);
+                if (part < 1 || part > 2)
+                    return usage(*av);
+                break;
+            case 'i':
+
+            default:
+                return usage(*av);
+        }
+    }
+    if (optind < ac)
+        return usage(*av);
+    return part;
+}

2022/day05/input/example.txt

@@ -0,0 +1,9 @@
+    [D]
+[N] [C]
+[Z] [M] [P]
+ 1   2   3
+
+move 1 from 2 to 1
+move 3 from 1 to 3
+move 2 from 2 to 1
+move 1 from 1 to 2

2022/day05/input/input.txt

@@ -0,0 +1,511 @@
+            [L] [M]         [M]
+        [D] [R] [Z]         [C] [L]
+        [C] [S] [T] [G]     [V] [M]
+[R]     [L] [Q] [B] [B]     [D] [F]
+[H] [B] [G] [D] [Q] [Z]     [T] [J]
+[M] [J] [H] [M] [P] [S] [V] [L] [N]
+[P] [C] [N] [T] [S] [F] [R] [G] [Q]
+[Z] [P] [S] [F] [F] [T] [N] [P] [W]
+ 1   2   3   4   5   6   7   8   9
+
+move 7 from 3 to 9
+move 5 from 8 to 9
+move 3 from 9 to 5
+move 6 from 9 to 2
+move 9 from 9 to 3
+move 3 from 7 to 3
+move 8 from 2 to 3
+move 9 from 3 to 1
+move 11 from 3 to 8
+move 5 from 6 to 9
+move 1 from 6 to 3
+move 1 from 2 to 7
+move 1 from 4 to 8
+move 1 from 3 to 9
+move 4 from 4 to 3
+move 6 from 8 to 3
+move 2 from 8 to 2
+move 4 from 9 to 3
+move 3 from 2 to 5
+move 2 from 5 to 4
+move 5 from 3 to 4
+move 11 from 1 to 4
+move 1 from 7 to 6
+move 1 from 3 to 5
+move 2 from 1 to 9
+move 1 from 1 to 4
+move 7 from 5 to 8
+move 21 from 4 to 6
+move 6 from 6 to 2
+move 6 from 8 to 9
+move 5 from 8 to 5
+move 2 from 2 to 7
+move 4 from 3 to 7
+move 1 from 2 to 6
+move 1 from 2 to 5
+move 2 from 2 to 7
+move 4 from 3 to 7
+move 1 from 4 to 6
+move 9 from 5 to 3
+move 7 from 3 to 4
+move 7 from 7 to 3
+move 7 from 4 to 1
+move 8 from 3 to 5
+move 1 from 3 to 5
+move 3 from 8 to 2
+move 2 from 2 to 9
+move 13 from 9 to 4
+move 5 from 5 to 3
+move 4 from 7 to 6
+move 1 from 7 to 4
+move 2 from 4 to 2
+move 3 from 3 to 4
+move 2 from 5 to 2
+move 6 from 1 to 7
+move 1 from 2 to 8
+move 1 from 3 to 8
+move 1 from 1 to 6
+move 1 from 3 to 4
+move 1 from 2 to 6
+move 24 from 6 to 1
+move 3 from 2 to 3
+move 3 from 3 to 5
+move 2 from 8 to 6
+move 2 from 5 to 4
+move 3 from 5 to 1
+move 7 from 4 to 8
+move 3 from 8 to 9
+move 2 from 9 to 5
+move 2 from 6 to 3
+move 1 from 9 to 8
+move 5 from 7 to 5
+move 2 from 3 to 1
+move 1 from 7 to 1
+move 7 from 4 to 7
+move 2 from 4 to 8
+move 6 from 8 to 6
+move 3 from 6 to 9
+move 10 from 5 to 1
+move 7 from 7 to 1
+move 1 from 4 to 9
+move 1 from 6 to 3
+move 2 from 9 to 7
+move 1 from 4 to 2
+move 1 from 9 to 5
+move 1 from 8 to 5
+move 39 from 1 to 8
+move 1 from 2 to 5
+move 2 from 6 to 9
+move 3 from 9 to 5
+move 3 from 1 to 6
+move 1 from 7 to 2
+move 1 from 3 to 2
+move 2 from 6 to 2
+move 3 from 2 to 3
+move 1 from 6 to 2
+move 1 from 1 to 8
+move 3 from 1 to 2
+move 3 from 2 to 4
+move 2 from 4 to 5
+move 2 from 3 to 8
+move 8 from 5 to 2
+move 8 from 8 to 2
+move 15 from 2 to 7
+move 1 from 1 to 5
+move 25 from 8 to 7
+move 2 from 2 to 4
+move 2 from 4 to 3
+move 1 from 8 to 4
+move 2 from 4 to 6
+move 1 from 2 to 1
+move 26 from 7 to 2
+move 15 from 2 to 1
+move 7 from 8 to 9
+move 10 from 1 to 6
+move 10 from 7 to 2
+move 1 from 8 to 1
+move 5 from 9 to 8
+move 1 from 8 to 9
+move 2 from 6 to 9
+move 3 from 7 to 1
+move 1 from 7 to 1
+move 5 from 9 to 2
+move 1 from 3 to 1
+move 9 from 6 to 3
+move 1 from 6 to 1
+move 4 from 2 to 4
+move 3 from 4 to 8
+move 1 from 4 to 1
+move 9 from 3 to 1
+move 1 from 7 to 6
+move 9 from 2 to 5
+move 14 from 1 to 6
+move 1 from 3 to 8
+move 5 from 2 to 6
+move 8 from 1 to 8
+move 6 from 6 to 8
+move 14 from 6 to 7
+move 1 from 1 to 7
+move 10 from 5 to 4
+move 11 from 8 to 5
+move 15 from 7 to 1
+move 4 from 5 to 6
+move 4 from 8 to 9
+move 6 from 5 to 3
+move 1 from 6 to 9
+move 1 from 1 to 6
+move 1 from 5 to 8
+move 2 from 6 to 2
+move 6 from 1 to 5
+move 1 from 5 to 8
+move 2 from 5 to 4
+move 9 from 2 to 9
+move 13 from 9 to 8
+move 1 from 2 to 1
+move 1 from 4 to 8
+move 3 from 3 to 1
+move 2 from 4 to 5
+move 2 from 1 to 5
+move 1 from 9 to 3
+move 17 from 8 to 1
+move 3 from 3 to 2
+move 4 from 5 to 1
+move 2 from 2 to 4
+move 1 from 6 to 1
+move 1 from 2 to 8
+move 4 from 4 to 6
+move 1 from 5 to 9
+move 5 from 6 to 8
+move 1 from 5 to 4
+move 1 from 5 to 6
+move 3 from 8 to 6
+move 8 from 4 to 5
+move 32 from 1 to 7
+move 11 from 7 to 6
+move 8 from 5 to 3
+move 3 from 8 to 7
+move 6 from 3 to 9
+move 4 from 3 to 8
+move 5 from 8 to 2
+move 1 from 8 to 5
+move 11 from 6 to 3
+move 1 from 5 to 2
+move 2 from 8 to 6
+move 12 from 7 to 8
+move 2 from 6 to 2
+move 2 from 6 to 4
+move 5 from 2 to 5
+move 8 from 7 to 2
+move 2 from 7 to 1
+move 2 from 7 to 6
+move 5 from 5 to 4
+move 5 from 4 to 7
+move 5 from 8 to 2
+move 2 from 9 to 7
+move 5 from 8 to 4
+move 2 from 7 to 3
+move 2 from 9 to 3
+move 3 from 7 to 9
+move 1 from 1 to 8
+move 2 from 6 to 1
+move 2 from 9 to 8
+move 1 from 7 to 8
+move 1 from 2 to 5
+move 1 from 7 to 9
+move 7 from 4 to 3
+move 3 from 3 to 6
+move 5 from 8 to 6
+move 3 from 9 to 5
+move 16 from 3 to 1
+move 2 from 9 to 1
+move 7 from 1 to 8
+move 1 from 1 to 2
+move 5 from 8 to 2
+move 12 from 1 to 4
+move 1 from 3 to 5
+move 1 from 2 to 9
+move 1 from 9 to 4
+move 4 from 6 to 5
+move 5 from 6 to 1
+move 1 from 6 to 5
+move 1 from 1 to 4
+move 1 from 4 to 7
+move 1 from 3 to 7
+move 9 from 4 to 6
+move 2 from 7 to 8
+move 1 from 3 to 4
+move 2 from 8 to 9
+move 4 from 8 to 4
+move 4 from 2 to 8
+move 2 from 9 to 7
+move 2 from 7 to 8
+move 10 from 2 to 4
+move 1 from 2 to 1
+move 5 from 4 to 7
+move 1 from 1 to 3
+move 3 from 8 to 7
+move 6 from 7 to 2
+move 3 from 2 to 7
+move 1 from 6 to 7
+move 5 from 5 to 8
+move 4 from 1 to 3
+move 4 from 3 to 1
+move 8 from 4 to 2
+move 1 from 3 to 2
+move 2 from 7 to 2
+move 2 from 6 to 3
+move 4 from 7 to 2
+move 4 from 5 to 7
+move 14 from 2 to 7
+move 3 from 2 to 1
+move 3 from 8 to 2
+move 1 from 5 to 7
+move 6 from 2 to 4
+move 2 from 2 to 7
+move 2 from 3 to 6
+move 6 from 8 to 2
+move 4 from 6 to 4
+move 2 from 6 to 9
+move 4 from 4 to 2
+move 2 from 4 to 8
+move 10 from 7 to 2
+move 18 from 2 to 6
+move 2 from 2 to 6
+move 2 from 9 to 2
+move 2 from 8 to 5
+move 1 from 2 to 9
+move 1 from 2 to 9
+move 1 from 5 to 7
+move 1 from 2 to 6
+move 2 from 9 to 2
+move 6 from 7 to 3
+move 7 from 6 to 8
+move 5 from 7 to 2
+move 1 from 7 to 4
+move 1 from 5 to 7
+move 4 from 8 to 7
+move 5 from 2 to 3
+move 1 from 7 to 5
+move 2 from 2 to 8
+move 9 from 4 to 3
+move 13 from 6 to 8
+move 10 from 3 to 1
+move 1 from 5 to 2
+move 3 from 6 to 8
+move 5 from 1 to 2
+move 1 from 1 to 8
+move 2 from 4 to 3
+move 17 from 8 to 6
+move 5 from 6 to 3
+move 3 from 1 to 2
+move 9 from 6 to 5
+move 2 from 6 to 8
+move 5 from 5 to 9
+move 3 from 9 to 8
+move 3 from 1 to 3
+move 3 from 7 to 5
+move 6 from 5 to 8
+move 7 from 2 to 4
+move 1 from 6 to 3
+move 1 from 1 to 5
+move 4 from 4 to 5
+move 2 from 2 to 9
+move 3 from 1 to 3
+move 4 from 5 to 8
+move 1 from 4 to 5
+move 6 from 8 to 7
+move 1 from 5 to 2
+move 4 from 9 to 2
+move 2 from 5 to 9
+move 2 from 1 to 8
+move 2 from 4 to 9
+move 6 from 7 to 5
+move 3 from 5 to 2
+move 3 from 2 to 5
+move 10 from 8 to 3
+move 2 from 8 to 5
+move 3 from 2 to 5
+move 6 from 5 to 1
+move 4 from 5 to 6
+move 1 from 7 to 5
+move 23 from 3 to 7
+move 2 from 5 to 9
+move 2 from 1 to 5
+move 2 from 6 to 3
+move 6 from 3 to 1
+move 1 from 1 to 7
+move 4 from 3 to 1
+move 1 from 8 to 5
+move 2 from 9 to 2
+move 3 from 3 to 8
+move 2 from 6 to 8
+move 12 from 1 to 3
+move 1 from 9 to 7
+move 3 from 5 to 9
+move 9 from 3 to 8
+move 1 from 1 to 7
+move 1 from 9 to 4
+move 3 from 3 to 6
+move 3 from 2 to 1
+move 3 from 8 to 6
+move 1 from 4 to 2
+move 1 from 2 to 9
+move 1 from 2 to 7
+move 20 from 7 to 5
+move 3 from 7 to 3
+move 3 from 1 to 3
+move 5 from 8 to 1
+move 5 from 1 to 5
+move 4 from 5 to 2
+move 3 from 2 to 6
+move 3 from 8 to 7
+move 1 from 2 to 6
+move 2 from 8 to 6
+move 2 from 7 to 5
+move 2 from 3 to 6
+move 12 from 5 to 1
+move 6 from 5 to 7
+move 12 from 6 to 8
+move 4 from 9 to 3
+move 4 from 5 to 8
+move 3 from 1 to 5
+move 4 from 7 to 4
+move 3 from 5 to 9
+move 7 from 1 to 6
+move 1 from 1 to 3
+move 6 from 7 to 6
+move 1 from 1 to 3
+move 10 from 3 to 6
+move 10 from 6 to 2
+move 2 from 9 to 5
+move 4 from 6 to 5
+move 9 from 6 to 1
+move 16 from 8 to 7
+move 3 from 8 to 7
+move 1 from 8 to 1
+move 7 from 2 to 1
+move 1 from 5 to 9
+move 1 from 6 to 1
+move 2 from 2 to 1
+move 3 from 1 to 4
+move 1 from 6 to 8
+move 7 from 4 to 1
+move 1 from 8 to 2
+move 22 from 1 to 8
+move 18 from 7 to 9
+move 6 from 5 to 2
+move 2 from 2 to 7
+move 2 from 1 to 5
+move 4 from 7 to 6
+move 1 from 5 to 6
+move 2 from 8 to 2
+move 3 from 2 to 6
+move 1 from 5 to 6
+move 15 from 9 to 6
+move 6 from 9 to 5
+move 1 from 9 to 8
+move 1 from 2 to 9
+move 5 from 5 to 9
+move 9 from 8 to 6
+move 3 from 2 to 7
+move 12 from 8 to 9
+move 1 from 7 to 5
+move 1 from 5 to 7
+move 3 from 7 to 1
+move 17 from 6 to 3
+move 1 from 2 to 6
+move 2 from 1 to 4
+move 16 from 6 to 4
+move 7 from 4 to 6
+move 1 from 5 to 7
+move 8 from 4 to 5
+move 9 from 9 to 8
+move 16 from 3 to 7
+move 1 from 1 to 5
+move 3 from 5 to 1
+move 5 from 6 to 2
+move 3 from 1 to 7
+move 3 from 6 to 7
+move 3 from 9 to 3
+move 5 from 8 to 5
+move 11 from 5 to 7
+move 2 from 3 to 7
+move 1 from 2 to 1
+move 1 from 3 to 6
+move 17 from 7 to 9
+move 1 from 3 to 2
+move 3 from 4 to 6
+move 1 from 1 to 2
+move 1 from 6 to 4
+move 14 from 7 to 6
+move 15 from 9 to 6
+move 4 from 8 to 7
+move 1 from 4 to 7
+move 7 from 9 to 5
+move 5 from 2 to 9
+move 7 from 5 to 1
+move 3 from 1 to 7
+move 29 from 6 to 4
+move 1 from 2 to 4
+move 18 from 4 to 2
+move 3 from 1 to 4
+move 1 from 1 to 7
+move 18 from 2 to 4
+move 3 from 6 to 5
+move 15 from 4 to 1
+move 1 from 5 to 1
+move 1 from 5 to 4
+move 9 from 4 to 1
+move 5 from 1 to 3
+move 9 from 1 to 5
+move 2 from 4 to 3
+move 5 from 5 to 6
+move 3 from 7 to 9
+move 7 from 7 to 5
+move 6 from 4 to 6
+move 2 from 3 to 7
+move 6 from 5 to 8
+move 2 from 8 to 4
+move 1 from 8 to 9
+move 9 from 6 to 2
+move 3 from 9 to 3
+move 1 from 2 to 1
+move 6 from 7 to 4
+move 2 from 2 to 8
+move 3 from 9 to 5
+move 5 from 4 to 8
+move 1 from 6 to 9
+move 1 from 3 to 1
+move 1 from 3 to 4
+move 1 from 6 to 5
+move 1 from 9 to 3
+move 10 from 8 to 7
+move 3 from 9 to 2
+move 7 from 2 to 4
+move 6 from 5 to 7
+move 4 from 5 to 8
+move 7 from 3 to 2
+move 3 from 7 to 1
+move 9 from 1 to 5
+move 5 from 7 to 9
+move 7 from 1 to 4
+move 11 from 4 to 2
+move 4 from 8 to 3
+move 5 from 4 to 7
+move 4 from 4 to 1
+move 1 from 3 to 6
+move 12 from 7 to 4
+move 2 from 1 to 8
+move 5 from 9 to 7
+move 7 from 5 to 6
+move 1 from 1 to 4
+move 1 from 9 to 8
+move 1 from 4 to 7
+move 1 from 8 to 9
+move 5 from 7 to 9
+move 2 from 7 to 5
+move 2 from 6 to 3
+move 5 from 2 to 7
+move 1 from 7 to 8
+move 1 from 1 to 6
+move 3 from 5 to 1

2022/day06/Makefile

@@ -0,0 +1,111 @@
+# AOC daily Makefile - GNU make only.
+#
+# Copyright (C) 2021-2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+#
+
+INPUT   := input/input.txt
+SHELL   := /bin/bash
+
+CC      := gcc
+BEAR    := bear
+CCLSFILE:= compile_commands.json
+
+LIB     := aoc_$(shell uname -m)
+INCDIR  := ../include
+LIBDIR  := ../lib
+LDFLAGS := -L$(LIBDIR)
+#LDLIB   := -l$(LIB) -lm
+LDLIB   := -l$(LIB)
+
+export LD_LIBRARY_PATH = $(LIBDIR)
+
+CFLAGS  += -std=gnu11
+CFLAGS  += -O2
+CFLAGS  += -g
+# for gprof
+# CFLAGS += -pg
+CFLAGS  += -Wall
+CFLAGS  += -Wextra
+CFLAGS  += -march=native
+# Next one may be useful for valgrind (some invalid instructions)
+# CFLAGS += -mno-tbm
+CFLAGS  += -Wmissing-declarations
+CFLAGS  += -Wno-unused-result
+
+CFLAGS  += -DDEBUG_DEBUG 	# activate general debug (debug.c)
+CFLAGS  += -DDEBUG_POOL		# memory pools management
+
+VALGRIND := valgrind
+VALGRINDFLAGS := --leak-check=full --show-leak-kinds=all --track-origins=yes \
+	--sigill-diagnostics=yes --quiet --show-error-list=yes
+
+
+TIME    := \time -f "\ttime: %E real, %U user, %S sys\n\tcontext-switch:\t%c+%w, page-faults: %F+%R\n"
+export PATH := .:$(PATH)
+
+.PHONY: clean all compile assembly memcheck memcheck1 memcheck2 part1 part2 ccls bear org
+
+all: README.org ccls part1 part2
+
+memcheck: memcheck1 memcheck2
+
+memcheck1: aoc-c
+	@$(VALGRIND) $(VALGRINDFLAGS) aoc-c -p 1 < $(INPUT)
+
+memcheck2: aoc-c
+	@$(VALGRIND) $(VALGRINDFLAGS) aoc-c -p 2 < $(INPUT)
+	@#@valgrind -s --track-origins=yes aoc-c -p 2 < $(INPUT)
+
+compile: aoc-c
+
+cpp: aoc-c.i
+
+assembly: aoc-c.s
+
+part1: aoc-c
+	@$(TIME) aoc.bash -p 1 < $(INPUT) 2>&1
+	@$(TIME) aoc-c -p 1 < $(INPUT)
+
+part2: aoc-c
+	@$(TIME) aoc.bash -p 2 < $(INPUT) 2>&1
+	@$(TIME) aoc-c -p 2 < $(INPUT)
+
+ccls: $(CCLSFILE)
+
+clean:
+	@rm -f aoc-c core* vgcore* gmon.out aoc-c.s aoc-c.i README.html compile_commands.json
+
+aoc-c: aoc-c.c common.c
+	@echo compiling $<
+	$(CC) $(CFLAGS) $(LDFLAGS) -I $(INCDIR) $^ $(LDLIB) -o $@
+
+# generate pre-processed file (.i) and assembler (.s)
+%.i: %.c
+	@echo generating $@
+	@$(CC) -E $(CFLAGS) -I $(INCDIR) $< -o $@
+
+%.s: %.c
+	@echo generating $@
+	@$(CC) -S -fverbose-asm $(CFLAGS) -I $(INCDIR) $< -o $@
+
+# generate README.org from README.html (must cleanup !)
+org: README.org
+
+%.org: %.html
+	@echo generating $@. Cleanup before commit !
+	@pandoc $< -o $@
+
+# generate compile_commands.json
+$(CCLSFILE): aoc-c.c Makefile
+	$(BEAR) -- make clean compile
+
+bear: clean
+	@touch .ccls-root
+	@$(BEAR) -- make compile

2022/day06/README.org

@@ -0,0 +1,85 @@
+** --- Day 6: Tuning Trouble ---
+The preparations are finally complete; you and the Elves leave camp on
+foot and begin to make your way toward the /star/ fruit grove.
+
+As you move through the dense undergrowth, one of the Elves gives you a
+handheld /device/. He says that it has many fancy features, but the most
+important one to set up right now is the /communication system/.
+
+However, because he's heard you have [[/2016/day/6][significant]]
+[[/2016/day/25][experience]] [[/2019/day/7][dealing]]
+[[/2019/day/9][with]] [[/2019/day/16][signal-based]]
+[[/2021/day/25][systems]], he convinced the other Elves that it would be
+okay to give you their one malfunctioning device - surely you'll have no
+problem fixing it.
+
+As if inspired by comedic timing, the device emits a few colorful
+sparks.
+
+To be able to communicate with the Elves, the device needs to /lock on
+to their signal/. The signal is a series of seemingly-random characters
+that the device receives one at a time.
+
+To fix the communication system, you need to add a subroutine to the
+device that detects a /start-of-packet marker/ in the datastream. In the
+protocol being used by the Elves, the start of a packet is indicated by
+a sequence of /four characters that are all different/.
+
+The device will send your subroutine a datastream buffer (your puzzle
+input); your subroutine needs to identify the first position where the
+four most recently received characters were all different. Specifically,
+it needs to report the number of characters from the beginning of the
+buffer to the end of the first such four-character marker.
+
+For example, suppose you receive the following datastream buffer:
+
+#+begin_example
+mjqjpqmgbljsphdztnvjfqwrcgsmlb
+#+end_example
+
+After the first three characters (=mjq=) have been received, there
+haven't been enough characters received yet to find the marker. The
+first time a marker could occur is after the fourth character is
+received, making the most recent four characters =mjqj=. Because =j= is
+repeated, this isn't a marker.
+
+The first time a marker appears is after the /seventh/ character
+arrives. Once it does, the last four characters received are =jpqm=,
+which are all different. In this case, your subroutine should report the
+value =7=, because the first start-of-packet marker is complete after 7
+characters have been processed.
+
+Here are a few more examples:
+
+- =bvwbjplbgvbhsrlpgdmjqwftvncz=: first marker after character =5=
+- =nppdvjthqldpwncqszvftbrmjlhg=: first marker after character =6=
+- =nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg=: first marker after character =10=
+- =zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw=: first marker after character =11=
+
+/How many characters need to be processed before the first
+start-of-packet marker is detected?/
+
+Your puzzle answer was =1658=.
+
+** --- Part Two ---
+Your device's communication system is correctly detecting packets, but
+still isn't working. It looks like it also needs to look for /messages/.
+
+A /start-of-message marker/ is just like a start-of-packet marker,
+except it consists of /14 distinct characters/ rather than 4.
+
+Here are the first positions of start-of-message markers for all of the
+above examples:
+
+- =mjqjpqmgbljsphdztnvjfqwrcgsmlb=: first marker after character =19=
+- =bvwbjplbgvbhsrlpgdmjqwftvncz=: first marker after character =23=
+- =nppdvjthqldpwncqszvftbrmjlhg=: first marker after character =23=
+- =nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg=: first marker after character =29=
+- =zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw=: first marker after character =26=
+
+/How many characters need to be processed before the first
+start-of-message marker is detected?/
+
+Your puzzle answer was =2260=.
+
+Both parts of this puzzle are complete! They provide two gold stars: **

2022/day06/aoc-c.c

@@ -0,0 +1,60 @@
+/* aoc-c.c: Advent of Code 2022, day 6
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <string.h>
+
+#include "br.h"
+#include "aoc.h"
+
+struct msg {
+    char *data;
+    size_t len;
+};
+
+static struct msg *parse(struct msg *msg)
+{
+    size_t alloc = 0;
+
+    msg->data=NULL;
+    msg->len = getline(&msg->data, &alloc, stdin);
+    msg->data[--msg->len] = 0;
+    return msg;
+}
+
+static int solve(struct msg *msg, int marklen)
+{
+    char *pcur = msg->data, *pnext = pcur;
+    int len = msg->len, lmark = 0;
+
+    for (; pnext < msg->data + len && lmark < marklen; lmark = ++pnext - pcur) {
+        for (int j = 0; j < lmark; ++j) {         /* compare with prev marker chars */
+            if (*(pcur+j) == *pnext) {            /* check new char with cur marker */
+                pcur += j + 1;                    /* move marker to after dup char */
+                goto nextchar;
+            }
+        }
+    nextchar: ;
+    }
+    return pnext - msg->data;
+}
+
+int main(int ac, char **av)
+{
+    int part = parseargs(ac, av);
+    struct msg msg;
+
+    printf("%s: res=%d\n", *av, solve(parse(&msg), part == 1? 4:14));
+    free(msg.data);
+    exit(0);
+}

2022/day06/aoc.bash

@@ -0,0 +1,46 @@
+#!/usr/bin/env bash
+#
+# aoc.bash: Advent of Code 2022, day 6
+#
+# Copyright (C) 2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+
+. common.bash
+
+declare input                                     # datastream
+declare -i len                                    # len of datastream
+
+parse() {
+    read -r input
+    len=${#input}
+}
+
+solve() {
+    declare -ig res
+    local -i mark=4 lcur=0 part="$1"
+    local cur next
+
+    ((part == 2)) && mark=14
+    for (( i = 0; i < len - mark; ++i )); do      # loop on all chars
+        next=${input:i:1}                         # next char
+        for ((j = 0; j < lcur; ++j)); do          # compare with previous ones
+            if [[ $next == "${cur:j:1}" ]]; then  # duplicate
+                cur="${cur:j+1}$next"             # keep str after dup + new char
+                (( lcur -= j ))
+                continue 2
+            fi
+        done
+        cur+="$next"                              # add new char
+        ((++lcur == mark)) && break               # mark len found
+    done
+    ((res = i + 1))
+}
+
+main "$@"
+exit 0

2022/day06/aoc.h

@@ -0,0 +1,17 @@
+/* aoc.c: Advent of Code 2022
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+#ifndef _AOC_H_
+#define _AOC_H_
+
+extern int parseargs(int ac, char**av);
+
+#endif  /* _AOC_H_ */

2022/day06/common.bash

@@ -0,0 +1,68 @@
+#!/usr/bin/env bash
+#
+# common.bash: Advent of Code 2022, common bash functions
+#
+# Copyright (C) 2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+
+# shellcheck disable=2034
+export cmdname=${0##*/}
+export debug=0
+export res
+export LANG=C
+
+shopt -s extglob
+set -o noglob
+
+usage() {
+    printf "usage: %s [-d DEBUG] [-p PART]\n" "$cmdname"
+    exit 1
+}
+
+checkargs() {
+    local part=1
+    while getopts p:d: todo; do
+        case "$todo" in
+            d)
+                if [[ "$OPTARG" =~ ^[[:digit:]+]$ ]]; then
+                    debug="$OPTARG"
+                else
+                    printf "%s: illegal [%s] debug level.\n" "$CMD" "$OPTARG"
+                    exit 1
+                fi
+                ;;
+            p)
+                if [[ "$OPTARG" =~ ^[12]$ ]]; then
+                    part="$OPTARG"
+                else
+                    printf "%s: illegal [%s] part.\n" "$CMD" "$OPTARG"
+                    exit 1
+                fi
+                ;;
+            *)
+                usage
+                ;;
+        esac
+    done
+    # Now check remaining argument (backup directory)
+    shift $((OPTIND - 1))
+
+    (( $# > 1 )) && usage
+    return "$part"
+}
+
+main() {
+    local -i part
+
+    checkargs "$@"
+    part=$?
+    parse "$part"
+    solve "$part"
+    printf "%s: res=%s\n" "$cmdname" "$res"
+}

2022/day06/common.c

@@ -0,0 +1,49 @@
+/* common.c: Advent of Code 2022, common functions
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <unistd.h>
+
+#include "aoc.h"
+#include "debug.h"
+
+static int usage(char *prg)
+{
+    fprintf(stderr, "Usage: %s [-d debug_level] [-p part] [-i input]\n", prg);
+    return 1;
+}
+
+int parseargs(int ac, char **av)
+{
+    int opt, part = 1;
+
+    while ((opt = getopt(ac, av, "d:p:")) != -1) {
+        switch (opt) {
+            case 'd':
+                debug_level_set(atoi(optarg));
+                break;
+            case 'p':                             /* 1 or 2 */
+                part = atoi(optarg);
+                if (part < 1 || part > 2)
+                    return usage(*av);
+                break;
+            case 'i':
+
+            default:
+                return usage(*av);
+        }
+    }
+    if (optind < ac)
+        return usage(*av);
+    return part;
+}

2022/day06/input/example.txt

@@ -0,0 +1 @@
+mjqjpqmgbljsphdztnvjfqwrcgsmlb

2022/day06/input/example2.txt

@@ -0,0 +1 @@
+bvwbjplbgvbhsrlpgdmjqwftvncz

2022/day06/input/example3.txt

@@ -0,0 +1 @@
+nppdvjthqldpwncqszvftbrmjlhg

2022/day06/input/example4.txt

@@ -0,0 +1 @@
+nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg

2022/day06/input/example5.txt

@@ -0,0 +1 @@
+zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw

2022/day06/input/input.txt

@@ -0,0 +1 @@
+cbhbmmqnmmqvqfqgqcqmmtvvvdsvscvssmfmhfmhhgdgcclhlnnvmnvmnnwngnqggqlqhhbqbfbvffcpfcfpcpmcppsgssvcvmmdwmwsmwswnwvnvvtgvgfgqqnlltgllpplhpllrnrwrtrzrlrzllpnlpnplnlwnnzfztzcchczctcbbpwpbbfhhqllgrllnnghnnlnznzzlqqmggqbgbjjlnlnjllwlnwnjnbjnnhhcddgmdmqmllfjllddmgmpggtvvqqwmmhcmmjpjdpdqqnhhqbhhscstsvttbwtwdtwwjffvccrwrvvnqqtwwhgwhwthwthhvshsfsjstshthqqdfdhdqhqrqggfffvhffhbbwtbtvtwvvwgvvjjjvtjvvlmlmtmztmthmhttjwwmqqjffhvhqvvrddbsbfbgffmcfffqqfzzgmggzvggbjjmccftcftfnttqqjzjdzdrrgvgsgvvlqvlqqlplnnjccjqcjcgjgfjgjlgjjzhhjbbbfdbfddgccncppsbbjjsttcqtqgqpqllqggtsthhtvvtrttbthtnhhddvnnbggmtggcsgcscmmvmllttjbjggbzbttrfttgsstwtftdthdththbttcggdldtdlttbvvpgpjpwpwvwcwjwsjsttznztzftzzjpzzrtzrztrrtsrrdtrdtdbdhhdgdwwnjnnvjvsjjrwjjvrrzvrvllrgghgbbgbsssslqlrllbjbttzfztzpzzvtvccszsddtqttjllqgqgpqphptpwttwtmtltljjfnnzwzmzlzssghssqhhphbhfftwwqmwmzzqtzqzqrrndrrmrqrzrszzrcrbccglgcgwgrgdggtvtpptgtfgflglgrrnvrvhrrhlrhhfchfhdhzzwggvbbgfgrrpdrdccfllqflfmlfmlmbbhnbbsblbzbgbqqjppcddcvvsddjfjjlnnwbbflfzzmlmddjssjffcqffwdfdqqphpnhppbttjfjzzdvdjvvddnfffmjfmfmpfmmmdlmlrrhqqcpcmclmmbmppzczjjmlltqlqzzqgqcggdmdzznnnnsjjvbjjwbwhbhfhvvtmmsfmmcgmcmwcwhwnhhpccmbmdbmbgbjbggqqccfllfqqmqwwzbblffthhdnncqnccqppldlpldpllzmmsqqdffnggqlqtllwlglnlnhlhflfssvzzrllbtbnbgnnfvfllwslszswsnnpwwppvspsmmnfnpffrmrhmmctttrjrbjrjpjtpjpssdwdtwtmmtgtsgttlwttfrfvvpjpcjccmtthhldhllzslshhnrnvvfddnllltclcrrhnnjwwwpfpddmtmsmfflslrlmlmwmllgfgmfgmmjttpcpspslsjspsqstqsqqpsprphrrpqqfzqqwcwcddsjjpvvfnfvnnnrncnwcwczzcwzwnwmwffbdfbdfdjjhrhvhhvwvsvhshnhwwzlwlnnphhtjjmljjqzjjsjgsjshhwjjmttvgvsgstggrcrmmrqrhrqrzrmzmggqvqtqgtqqqqltqqwggmmzggjccgmgwgqqmnqnrnprptrrvfrvffnmnfmmnnnwzzldlvlgvlvqqpnphpgglhlshlhzzpcptpssblqvdbpbbcrngctqgptccwpdcpbcjwdmcrzmhwffgzqmmqwpqvplwzmjlzmvmzmbtqjnhzrpppnpntvmjbzmvhjvbgflmmjnwssvqvbnbddfcwqdtvpvddctmpptcjmvwszhbsttcbjlfjvwlljhlqlvvsnzphdjhfswltdhzprltzcszrgcmnmfznmbccstjvjngwpbsfqssfwvpdhhmlmzttzlszsgpvvbcfvzrlsttlqpnqhwtbqfjnbztnwfnhlhfltgdtsrrwrfhlssvsgzpffnnrhgcvclqnjgfhhzswllvcjffpngcmtjphwnbdfrrgjfrfqbnvbwgccsjvvmjgcvqvtggnvgvgnnchbblqnvvdgjtvdmfrzvhvhzcbqzdslphjjqtcwjqptstvvpqgdbgbcmmchjpvjhvbwtlmlnqpldfcbmwvrmpqcsfdhmmwnbvmpglcfbnsgjmljcwpzpwffcqfrbdrztzhqzhzpcrjfdmrctttdrzlmzcqwjftngwjmgqscftnpbjwqrcvqwbwbdhbhvrdcvgrvctjgwjtmdgzwgvdbmsrjpsbhwcqlqzjnzmgpctlwqhfnbmgsprjcqtfjjvzljqpfqgnvrgnjjlmpqgnzpmpsvzjmtvnfgslldjtjdwlzrvqrbvcpspzpcdnpdjmhcdhsbmthmgjqchqwwsnfjnwgpctlwcdpqpmzqcrptscngqnmhzwjdcqwvdmlzntsfbstbtmmnlsspjbjjdspnslgcnlbfnbhjlzjhrrmdbbwtswqpbpwtzhcnldbsfrvndzvcgzjprcrclhfwbvzgthcglfzqrshgtvbflvnznhmlzdtfnrsltnnppqgrtndbsfqmftdnzmqfwdpcrmssldmrrnzchnqpflgbqzqjjrzlfnptqdwzdhmctfbztmfcmbqcwjmgnwgqzqjctphrrthgvpvppztvpzgzhdszfhlzlcnwmfrlsnvftfrlfvbnlwzctphhpfvszntqcvnfmvmwwhsjlnpfhcpjvrncgmsbprwwllvnsbjfhtbtmcvvpzcvqrrqdvgzvllvcvnvvbftngqcqcvvbsqfshmnhwptcsbsnjzltqzmflftrhblqszrzsbfcpgzncvwhlqlcbmgjdpfcmlgdfphsfcgqccthmlzjbdwpsbddwwrtwmsvqwbzwhzmghhrspvbptznqsqvhgnhlwqjnhgnzprrtjddwtqfsshjrvlglhdlstghftmllvzmmfglnscnrtgcwwwzjphzhvqlctdwjlqvbsvlgzrdpvjhhcthgjhlwsgfzlschhfprfcrzfrzmnlwvqsnqlllczwfhswchrlggqszwrvpldrffnzrffbhtfbslgcdrqpjcrbqsrgfrhttcptncfndcbsdbjsqjvgbmnmhlnbltdcgbmllpgjmgljvglrwmrvgthhhzrsmzvgwcfgvcsbzpjcqnhrzhznzjcjghhwqvllrmsvlpzlssrdsqwvzvqwsvfsjqvbgrfbmfzlchqsjgncbljtvzsfdnvmfzcbrlnnvvmjbmgjmqzjtdzpljdwqtvwsrlbslwfvlgbtnmlpcwmngncnmdhqctshmjmnhpqcqzhvlbvgptctrvggdgnpnrlnngrfhsqdfthvcnpwjfjnslcqlfrfvhnctmsqgnqmgpwtlzhtdqhqqrcllzjccnszsqvrzhcffvnfnstgdmljdrqrndljdnfbbjvmpqdnqhtdlnzcvnfjlvzmfzrndhtglvngmbrdbpbnhvfmrbcwqzttnjplgrhchjtfjwfbjfbmzlrnllhzccpfhfhnjpfvzlpbqnhwmpssvwtzhdbtnbtllhpfdcqjjnzgbdrfjjbcltnzdrmtmsmvpjtmdnqszgbqncsvhjbgwswhmghpvstrqbglgrtgbchttbznvvdhppzwnttpgcbdjdhlsqhhtlphjjrjncrmfdtjhdwmjgmpngnbptzwgwdztmhtpglnftwpnnmrmcwfhwnhlsbwsrjnlmdlmffbzsnhsvnbldwtrrhdhfsjdrsnzlgtfzcwwqrfhtrmjhmphqndwtbpczvmfgczmdlqjqdlwmvjjzwmqnpvwzmtjwtprlnbvjdhpjgndrwzcfthnwhnhqpwtcjlhrhdplzsncfmszmhjmgljhnlsrrfwplclcvjjqmtpnwbtsbwdnjdlqntvdnfgwbpwspssprbffjdlcvbwcqlttnwnhwdspfsjhppbhspnrvrsfmzvbwwtjfzmnzwgqddbmcjzzqhqlgrglsvgsjdwlnsbtmqgsnfwwqrjsbcgdlmbgqwvgpqllqwbcplfjrgnzsdtdtvqnrbcrqjhdtqqplvszvtlflgbpwnpzczbvhzfjrslcwcswsgfvvsswzzwhtfjfpsrvcfnrs

2022/day07/Makefile

@@ -0,0 +1,111 @@
+# AOC daily Makefile - GNU make only.
+#
+# Copyright (C) 2021-2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+#
+
+INPUT   := input/input.txt
+SHELL   := /bin/bash
+
+CC      := gcc
+BEAR    := bear
+CCLSFILE:= compile_commands.json
+
+LIB     := aoc_$(shell uname -m)
+INCDIR  := ../include
+LIBDIR  := ../lib
+LDFLAGS := -L$(LIBDIR)
+#LDLIB   := -l$(LIB) -lm
+LDLIB   := -l$(LIB)
+
+export LD_LIBRARY_PATH = $(LIBDIR)
+
+CFLAGS  += -std=gnu11
+CFLAGS  += -O2
+CFLAGS  += -g
+# for gprof
+# CFLAGS += -pg
+CFLAGS  += -Wall
+CFLAGS  += -Wextra
+CFLAGS  += -march=native
+# Next one may be useful for valgrind (some invalid instructions)
+# CFLAGS += -mno-tbm
+CFLAGS  += -Wmissing-declarations
+CFLAGS  += -Wno-unused-result
+
+CFLAGS  += -DDEBUG_DEBUG 	# activate general debug (debug.c)
+CFLAGS  += -DDEBUG_POOL		# memory pools management
+
+VALGRIND := valgrind
+VALGRINDFLAGS := --leak-check=full --show-leak-kinds=all --track-origins=yes \
+	--sigill-diagnostics=yes --quiet --show-error-list=yes
+
+
+TIME    := \time -f "\ttime: %E real, %U user, %S sys\n\tcontext-switch:\t%c+%w, page-faults: %F+%R\n"
+export PATH := .:$(PATH)
+
+.PHONY: clean all compile assembly memcheck memcheck1 memcheck2 part1 part2 ccls bear org
+
+all: README.org ccls part1 part2
+
+memcheck: memcheck1 memcheck2
+
+memcheck1: aoc-c
+	@$(VALGRIND) $(VALGRINDFLAGS) aoc-c -p 1 < $(INPUT)
+
+memcheck2: aoc-c
+	@$(VALGRIND) $(VALGRINDFLAGS) aoc-c -p 2 < $(INPUT)
+	@#@valgrind -s --track-origins=yes aoc-c -p 2 < $(INPUT)
+
+compile: aoc-c
+
+cpp: aoc-c.i
+
+assembly: aoc-c.s
+
+part1: aoc-c
+	@$(TIME) aoc.bash -p 1 < $(INPUT) 2>&1
+	@$(TIME) aoc-c -p 1 < $(INPUT)
+
+part2: aoc-c
+	@$(TIME) aoc.bash -p 2 < $(INPUT) 2>&1
+	@$(TIME) aoc-c -p 2 < $(INPUT)
+
+ccls: $(CCLSFILE)
+
+clean:
+	@rm -f aoc-c core* vgcore* gmon.out aoc-c.s aoc-c.i README.html compile_commands.json
+
+aoc-c: aoc-c.c common.c
+	@echo compiling $<
+	$(CC) $(CFLAGS) $(LDFLAGS) -I $(INCDIR) $^ $(LDLIB) -o $@
+
+# generate pre-processed file (.i) and assembler (.s)
+%.i: %.c
+	@echo generating $@
+	@$(CC) -E $(CFLAGS) -I $(INCDIR) $< -o $@
+
+%.s: %.c
+	@echo generating $@
+	@$(CC) -S -fverbose-asm $(CFLAGS) -I $(INCDIR) $< -o $@
+
+# generate README.org from README.html (must cleanup !)
+org: README.org
+
+%.org: %.html
+	@echo generating $@. Cleanup before commit !
+	@pandoc $< -o $@
+
+# generate compile_commands.json
+$(CCLSFILE): aoc-c.c Makefile
+	$(BEAR) -- make clean compile
+
+bear: clean
+	@touch .ccls-root
+	@$(BEAR) -- make compile

2022/day07/README.org

@@ -0,0 +1,156 @@
+** --- Day 7: No Space Left On Device ---
+You can hear birds chirping and raindrops hitting leaves as the
+expedition proceeds. Occasionally, you can even hear much louder sounds
+in the distance; how big do the animals get out here, anyway?
+
+The device the Elves gave you has problems with more than just its
+communication system. You try to run a system update:
+
+#+begin_example
+$ system-update --please --pretty-please-with-sugar-on-top
+Error: No space left on device
+#+end_example
+
+Perhaps you can delete some files to make space for the update?
+
+You browse around the filesystem to assess the situation and save the
+resulting terminal output (your puzzle input). For example:
+
+#+begin_example
+$ cd /
+$ ls
+dir a
+14848514 b.txt
+8504156 c.dat
+dir d
+$ cd a
+$ ls
+dir e
+29116 f
+2557 g
+62596 h.lst
+$ cd e
+$ ls
+584 i
+$ cd ..
+$ cd ..
+$ cd d
+$ ls
+4060174 j
+8033020 d.log
+5626152 d.ext
+7214296 k
+#+end_example
+
+The filesystem consists of a tree of files (plain data) and directories
+(which can contain other directories or files). The outermost directory
+is called =/=. You can navigate around the filesystem, moving into or
+out of directories and listing the contents of the directory you're
+currently in.
+
+Within the terminal output, lines that begin with =$= are /commands you
+executed/, very much like some modern computers:
+
+- =cd= means /change directory/. This changes which directory is the
+  current directory, but the specific result depends on the argument:
+  - =cd x= moves /in/ one level: it looks in the current directory for
+    the directory named =x= and makes it the current directory.
+  - =cd ..= moves /out/ one level: it finds the directory that contains
+    the current directory, then makes that directory the current
+    directory.
+  - =cd /= switches the current directory to the outermost directory,
+    =/=.
+- =ls= means /list/. It prints out all of the files and directories
+  immediately contained by the current directory:
+  - =123 abc= means that the current directory contains a file named
+    =abc= with size =123=.
+  - =dir xyz= means that the current directory contains a directory
+    named =xyz=.
+
+Given the commands and output in the example above, you can determine
+that the filesystem looks visually like this:
+
+#+begin_example
+- / (dir)
+  - a (dir)
+    - e (dir)
+      - i (file, size=584)
+    - f (file, size=29116)
+    - g (file, size=2557)
+    - h.lst (file, size=62596)
+  - b.txt (file, size=14848514)
+  - c.dat (file, size=8504156)
+  - d (dir)
+    - j (file, size=4060174)
+    - d.log (file, size=8033020)
+    - d.ext (file, size=5626152)
+    - k (file, size=7214296)
+#+end_example
+
+Here, there are four directories: =/= (the outermost directory), =a= and
+=d= (which are in =/=), and =e= (which is in =a=). These directories
+also contain files of various sizes.
+
+Since the disk is full, your first step should probably be to find
+directories that are good candidates for deletion. To do this, you need
+to determine the /total size/ of each directory. The total size of a
+directory is the sum of the sizes of the files it contains, directly or
+indirectly. (Directories themselves do not count as having any intrinsic
+size.)
+
+The total sizes of the directories above can be found as follows:
+
+- The total size of directory =e= is /584/ because it contains a single
+  file =i= of size 584 and no other directories.
+- The directory =a= has total size /94853/ because it contains files =f=
+  (size 29116), =g= (size 2557), and =h.lst= (size 62596), plus file =i=
+  indirectly (=a= contains =e= which contains =i=).
+- Directory =d= has total size /24933642/.
+- As the outermost directory, =/= contains every file. Its total size is
+  /48381165/, the sum of the size of every file.
+
+To begin, find all of the directories with a total size of /at most
+100000/, then calculate the sum of their total sizes. In the example
+above, these directories are =a= and =e=; the sum of their total sizes
+is =95437= (94853 + 584). (As in this example, this process can count
+files more than once!)
+
+Find all of the directories with a total size of at most 100000. /What
+is the sum of the total sizes of those directories?/
+
+Your puzzle answer was =1390824=.
+
+** --- Part Two ---
+Now, you're ready to choose a directory to delete.
+
+The total disk space available to the filesystem is =70000000=. To run
+the update, you need unused space of at least =30000000=. You need to
+find a directory you can delete that will /free up enough space/ to run
+the update.
+
+In the example above, the total size of the outermost directory (and
+thus the total amount of used space) is =48381165=; this means that the
+size of the /unused/ space must currently be =21618835=, which isn't
+quite the =30000000= required by the update. Therefore, the update still
+requires a directory with total size of at least =8381165= to be deleted
+before it can run.
+
+To achieve this, you have the following options:
+
+- Delete directory =e=, which would increase unused space by =584=.
+- Delete directory =a=, which would increase unused space by =94853=.
+- Delete directory =d=, which would increase unused space by =24933642=.
+- Delete directory =/=, which would increase unused space by =48381165=.
+
+Directories =e= and =a= are both too small; deleting them would not free
+up enough space. However, directories =d= and =/= are both big enough!
+Between these, choose the /smallest/: =d=, increasing unused space by
+=24933642=.
+
+Find the smallest directory that, if deleted, would free up enough space
+on the filesystem to run the update. /What is the total size of that
+directory?/
+
+Your puzzle answer was =7490863=.
+
+Both parts of this puzzle are complete! They provide two gold stars: **

2022/day07/aoc-c.c

@@ -0,0 +1,194 @@
+/* aoc-c.c: Advent of Code 2022, day 7
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <string.h>
+#include <ctype.h>
+
+#include "pool.h"
+#include "debug.h"
+#include "br.h"
+#include "aoc.h"
+#include "hashtable.h"
+#include "pjwhash-inline.h"
+
+/* we will totally ignore the tree structure here and only keep a hashtable
+ * to keep directories sizes.
+ */
+#define HBITS 9                                   /* 9 bits: size is 512 */
+#define DIRNAME_SIZE 128
+
+DEFINE_HASHTABLE(hasht_dir, HBITS);
+
+typedef struct dir {
+    char name[DIRNAME_SIZE];
+    uint namelen;
+    uint hash;
+    int size;
+    struct hlist_node hlist;
+} dir_t;
+
+static pool_t *pool_dirs;
+
+/**
+ * find_dir - find entry in an hashtable bucket
+ */
+static dir_t *find_dir(struct hlist_head *head, uint hash, char *dir, uint len)
+{
+    dir_t *cur;
+
+    hlist_for_each_entry(cur, head, hlist)
+        if (cur->hash == hash && cur->namelen == len && !memcmp(cur->name, dir, len))
+                return cur;
+    return NULL;
+}
+
+static dir_t *find_dirname(char *name, uint len)
+{
+    uint hash = pjwhash(name, len);
+    uint bucket = hash_32(hash, HBITS);
+
+    return find_dir(&hasht_dir[bucket], hash, name, len);
+}
+
+/**
+ * parent_dir - get new len of parent directory
+ */
+static int parent_dir(char *dir, uint len)
+{
+    for (--len; len && *(dir + len) != '/'; --len)
+        ;
+    return len? len: 1;
+}
+
+static void adjust_dirsize(dir_t *dir, uint size)
+{
+    dir_t *cur = dir;
+    uint len = cur->namelen;
+
+    while (len > 1) {
+        cur = find_dirname(dir->name, len);
+        if (!cur) {
+            log(1, "FATAL hash issue");
+            exit(1);
+        }
+        cur->size +=size;
+        len = parent_dir(dir->name, len);
+    };
+    cur = find_dirname("/", 1);                   /* do not forget "/" */
+    cur->size += size;
+}
+
+/**
+ * add_dir - add an entry in hashtable
+ */
+static struct dir *add_dir(char *dir, uint len)
+{
+    uint hash = pjwhash(dir, len);
+    uint bucket = hash_32(hash, HBITS);
+    dir_t *new = pool_get(pool_dirs);
+
+    memcpy(new->name, dir, len);
+    new->namelen = len;
+    new->hash = hash;
+    new->size = 0;
+    hlist_add_head(&new->hlist, &hasht_dir[bucket]);
+    return new;
+}
+
+/**
+ * add_dir_maybe - add an entry in hashtable if it does not exist
+ */
+static struct dir *add_dir_maybe(char *dir, int len)
+{
+    dir_t *new = find_dirname(dir, len);
+    return new? new: add_dir(dir, len);
+}
+
+static struct dir *cd(struct dir *dir, char *to, uint tolen)
+{
+    char *newname = dir->name;
+    int newlen, add_slash = 0;
+
+    if (!dir)
+        return add_dir_maybe(to, tolen);
+    if (dir->namelen + tolen + 1 > DIRNAME_SIZE)  /* conservative (think / or ..) */
+        return NULL;
+    if (*to == '.') {                             /* .. = parent dir */
+        newlen = parent_dir(dir->name, dir->namelen);
+    } else if (*to == '/') {                      /* root */
+        newname = to;
+        newlen = tolen;
+    } else {                                      /* subdir */
+        newlen = dir->namelen + tolen;
+        if (dir->namelen > 1) {                   /* add '/' separator */
+            dir->name[dir->namelen] = '/';
+            add_slash = 1;
+            newlen++;
+        }
+        memcpy(dir->name + dir->namelen + add_slash, to, tolen);
+    }
+    return add_dir_maybe(newname, newlen);
+}
+
+#define CDLEN (sizeof("$ cd ") - 1)
+
+static void parse()
+{
+    dir_t *curdir = NULL;
+    size_t alloc = 0;
+    char *buf = NULL, *tok;
+    ssize_t buflen;
+
+    while ((buflen = getline(&buf, &alloc, stdin)) > 0) {
+        buf[--buflen] = 0;
+        tok = buf;
+        if (*tok == '$' &&*(tok+2) == 'c')        /* ignore "ls"" */
+            curdir = cd(curdir, tok + CDLEN, buflen - CDLEN);
+        else if (isdigit(*tok))                   /* ignore "dir" keyword */
+            adjust_dirsize(curdir, atoi(tok));
+    }
+    free(buf);
+    return;
+}
+
+static int solve(int part)
+{
+    ulong bucket;
+    dir_t *cur;
+    int res = 0, needed;
+
+    if (part == 1) {
+        hash_for_each(hasht_dir, bucket, cur, hlist)
+            if (cur->size <= 100000)
+                res += cur->size;
+    } else {
+        res = find_dirname("/", 1)->size;
+        needed = res - (70000000-30000000);
+        hash_for_each(hasht_dir, bucket, cur, hlist)
+            if (cur->size >= needed && cur->size < res)
+                res = cur->size;
+    }
+    return res;
+}
+
+int main(int ac, char **av)
+{
+    int part = parseargs(ac, av);
+    pool_dirs = pool_create("dirs", 128, sizeof(dir_t));
+
+    parse();
+    printf("%s: res=%d\n", *av, solve(part));
+    pool_destroy(pool_dirs);
+    exit(0);
+}

2022/day07/aoc.bash

@@ -0,0 +1,102 @@
+#!/usr/bin/env bash
+#
+# aoc.bash: Advent of Code 2022, day 7
+#
+# Copyright (C) 2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+
+. common.bash
+
+declare -A sizes=()                               # file size
+declare -A dirs=()                                # directories
+declare -a lines                                  # shell lines
+declare -i curline=0                              # current line in shell
+declare curdir
+
+do_cd() {
+    local dir="$1"
+    case "$dir" in
+        "..")
+            curdir=${curdir%/*}
+            [[ -z $curdir ]] && curdir="/"
+            ;;
+        "/")
+            curdir="/"
+            ;;
+        *)
+            [[ $curdir != "/" ]] && curdir+="/"
+            curdir+="$dir"
+    esac
+    dirs[$curdir]="$curdir"
+}
+
+do_ls() {
+    local remain
+    local -i size
+    ((curline++))
+    while [[ $curline -lt ${#lines[@]} && ${lines[$curline]:0:1} != "\$" ]]; do
+        if [[ "${lines[$curline]}" != dir* ]]; then
+            size=${lines[$curline]% *}
+            remain="$curdir"
+            while [[ -n $remain ]]; do        # recurse up curdir and adjust sizes
+                ((sizes[$remain] += size))
+                remain=${remain%/*}
+            done
+            (( sizes["/"] += size ))
+        fi
+        ((curline++))
+    done
+    ((curline--))
+}
+
+parse() {
+    readarray -t lines
+    curline=0
+    declare -a line
+
+    while ((curline < ${#lines[@]})); do
+        read -ra line <<< "${lines[$curline]}"
+        case "${line[1]}" in
+            "cd")
+                do_cd "${line[2]}"
+                ;;
+            "ls")
+                do_ls
+                ;;
+        esac
+        ((curline++))
+    done
+}
+
+solve() {
+    declare -ig res
+    local part="$1" dir mindir="/"
+    local -i needed
+
+    if ((part == 1)); then
+        for dir in "${dirs[@]}"; do
+            ((sizes[$dir] <= 100000 )) && ((res+=sizes[$dir]))
+        done
+    else
+        (( res = sizes["/"] ))
+        (( needed = sizes["/"] - (70000000-30000000) ))
+        for dir in "${!dirs[@]}"; do
+            if (( sizes[$dir] >= needed )); then
+                if (( sizes[$dir] <= res )); then
+                    mindir=$dir
+                    ((res = sizes[$mindir]))
+                fi
+            fi
+        done
+
+    fi
+}
+
+main "$@"
+exit 0

2022/day07/aoc.h

@@ -0,0 +1,17 @@
+/* aoc.c: Advent of Code 2022
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+#ifndef _AOC_H_
+#define _AOC_H_
+
+extern int parseargs(int ac, char**av);
+
+#endif  /* _AOC_H_ */

2022/day07/common.bash

@@ -0,0 +1,68 @@
+#!/usr/bin/env bash
+#
+# common.bash: Advent of Code 2022, common bash functions
+#
+# Copyright (C) 2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+
+# shellcheck disable=2034
+export cmdname=${0##*/}
+export debug=0
+export res
+export LANG=C
+
+shopt -s extglob
+set -o noglob
+
+usage() {
+    printf "usage: %s [-d DEBUG] [-p PART]\n" "$cmdname"
+    exit 1
+}
+
+checkargs() {
+    local part=1
+    while getopts p:d: todo; do
+        case "$todo" in
+            d)
+                if [[ "$OPTARG" =~ ^[[:digit:]+]$ ]]; then
+                    debug="$OPTARG"
+                else
+                    printf "%s: illegal [%s] debug level.\n" "$CMD" "$OPTARG"
+                    exit 1
+                fi
+                ;;
+            p)
+                if [[ "$OPTARG" =~ ^[12]$ ]]; then
+                    part="$OPTARG"
+                else
+                    printf "%s: illegal [%s] part.\n" "$CMD" "$OPTARG"
+                    exit 1
+                fi
+                ;;
+            *)
+                usage
+                ;;
+        esac
+    done
+    # Now check remaining argument (backup directory)
+    shift $((OPTIND - 1))
+
+    (( $# > 1 )) && usage
+    return "$part"
+}
+
+main() {
+    local -i part
+
+    checkargs "$@"
+    part=$?
+    parse "$part"
+    solve "$part"
+    printf "%s: res=%s\n" "$cmdname" "$res"
+}

2022/day07/common.c

@@ -0,0 +1,49 @@
+/* common.c: Advent of Code 2022, common functions
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <unistd.h>
+
+#include "aoc.h"
+#include "debug.h"
+
+static int usage(char *prg)
+{
+    fprintf(stderr, "Usage: %s [-d debug_level] [-p part] [-i input]\n", prg);
+    return 1;
+}
+
+int parseargs(int ac, char **av)
+{
+    int opt, part = 1;
+
+    while ((opt = getopt(ac, av, "d:p:")) != -1) {
+        switch (opt) {
+            case 'd':
+                debug_level_set(atoi(optarg));
+                break;
+            case 'p':                             /* 1 or 2 */
+                part = atoi(optarg);
+                if (part < 1 || part > 2)
+                    return usage(*av);
+                break;
+            case 'i':
+
+            default:
+                return usage(*av);
+        }
+    }
+    if (optind < ac)
+        return usage(*av);
+    return part;
+}

2022/day07/input/example.txt

@@ -0,0 +1,23 @@
+$ cd /
+$ ls
+dir a
+14848514 b.txt
+8504156 c.dat
+dir d
+$ cd a
+$ ls
+dir e
+29116 f
+2557 g
+62596 h.lst
+$ cd e
+$ ls
+584 i
+$ cd ..
+$ cd ..
+$ cd d
+$ ls
+4060174 j
+8033020 d.log
+5626152 d.ext
+7214296 k

2022/day07/input/input.txt

@@ -0,0 +1,950 @@
+$ cd /
+$ ls
+dir cvt
+4967 hcqbmwc.gts
+5512 hsbhwb.clj
+dir hvfvt
+dir phwgv
+277125 pwgswq.fld
+42131 qdzr.btl
+dir svw
+144372 vmbnlzgb.wbd
+dir zft
+$ cd cvt
+$ ls
+dir bbgsthsd
+146042 bcqrmp.czf
+dir chhdjtlw
+dir cpcfcc
+dir dch
+dir djb
+dir djfww
+dir drdf
+dir fgbqtjlj
+dir hjsmmj
+243293 hvfvt.qtb
+245795 lrpb
+dir msptbrl
+181756 qlqqmndd.zcb
+18658 rtfzt.tjp
+dir slpc
+$ cd bbgsthsd
+$ ls
+236957 djfww.fcb
+112286 hcqbmwc.gts
+106102 qggjrzts
+$ cd ..
+$ cd chhdjtlw
+$ ls
+226927 cpcfcc
+309815 djfww
+117933 hcqbmwc.gts
+dir mbdrgfzs
+dir pbmcnpzf
+131558 pwgswq.fld
+298691 qlqqmndd.zcb
+$ cd mbdrgfzs
+$ ls
+164331 hvfvt.dvq
+$ cd ..
+$ cd pbmcnpzf
+$ ls
+102120 bjgg.cqd
+$ cd ..
+$ cd ..
+$ cd cpcfcc
+$ ls
+15756 ddc
+dir dqc
+dir glm
+dir jbszm
+200345 pwgswq.fld
+145508 qlqqmndd.zcb
+dir vcptbw
+dir zrtm
+$ cd dqc
+$ ls
+dir cpcfcc
+92063 mzp
+dir qmhnvmh
+dir snqqcjlw
+8423 zdjwr.blc
+$ cd cpcfcc
+$ ls
+dir hvfvt
+$ cd hvfvt
+$ ls
+289372 pwgswq.fld
+307397 qlqqmndd.zcb
+$ cd ..
+$ cd ..
+$ cd qmhnvmh
+$ ls
+274778 jczjwdl.smd
+194322 ngrrfm
+$ cd ..
+$ cd snqqcjlw
+$ ls
+182851 nprvrgd.tbb
+$ cd ..
+$ cd ..
+$ cd glm
+$ ls
+188702 hpq.hgm
+$ cd ..
+$ cd jbszm
+$ ls
+187645 pwgswq.fld
+$ cd ..
+$ cd vcptbw
+$ ls
+dir mgqd
+$ cd mgqd
+$ ls
+157695 rhldvntj.jzm
+268696 rjnngctw
+$ cd ..
+$ cd ..
+$ cd zrtm
+$ ls
+218820 bcqrmp.czf
+172319 czpsl.dnf
+180114 hcqbmwc.gts
+165216 hvfvt.nnw
+dir zft
+$ cd zft
+$ ls
+161245 dtqjg.czv
+249888 hpq.hgm
+192037 zft
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dch
+$ ls
+dir djfww
+dir fzqgwwnf
+dir hqvmq
+dir mmcrzqc
+42136 qlqqmndd.zcb
+dir vdtlh
+dir wfltm
+271200 zrtm
+$ cd djfww
+$ ls
+37427 dct
+204401 hcqbmwc.gts
+283140 jmq
+dir lbrhbc
+154148 pncb.bmp
+53366 vzt.cnn
+$ cd lbrhbc
+$ ls
+dir djfww
+153648 djfww.pps
+308911 mvtjzp.btg
+219150 ncmc
+253604 wqft.ggb
+293759 zft
+$ cd djfww
+$ ls
+24794 hcqbmwc.gts
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd fzqgwwnf
+$ ls
+233720 scdd.pwr
+$ cd ..
+$ cd hqvmq
+$ ls
+dir cdld
+dir cpcfcc
+dir djfww
+85564 hpq.hgm
+dir qnc
+81509 wtnl.crs
+$ cd cdld
+$ ls
+293421 llpltsgn.tqb
+$ cd ..
+$ cd cpcfcc
+$ ls
+230813 cglljgv
+178203 qlqqmndd.zcb
+186410 zrtm.tbt
+$ cd ..
+$ cd djfww
+$ ls
+201830 zrtm
+$ cd ..
+$ cd qnc
+$ ls
+305356 bdf.jrh
+dir zrtm
+$ cd zrtm
+$ ls
+dir bdhdrr
+$ cd bdhdrr
+$ ls
+dir nffdrnb
+$ cd nffdrnb
+$ ls
+301601 nbrjz
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd mmcrzqc
+$ ls
+dir cpcfcc
+264271 hpq.hgm
+208744 tzsjrf.zdc
+274096 zft
+$ cd cpcfcc
+$ ls
+226054 cpcfcc
+$ cd ..
+$ cd ..
+$ cd vdtlh
+$ ls
+84229 bzlg.crn
+58668 cpcfcc.zqw
+141409 hpq.hgm
+dir mdgst
+37090 pstsh.qwv
+40357 qlqqmndd.zcb
+dir smr
+dir sqbgcsgh
+dir trp
+$ cd mdgst
+$ ls
+151033 fsmvbpsl.nqr
+$ cd ..
+$ cd smr
+$ ls
+140764 cpcfcc.dpg
+$ cd ..
+$ cd sqbgcsgh
+$ ls
+dir djfww
+263783 dvm
+105219 hpq.hgm
+29647 hwcgv.gvg
+162537 lwjhgh.wmt
+235511 nlw
+dir zwddrdfz
+$ cd djfww
+$ ls
+260084 vcgpvpd
+$ cd ..
+$ cd zwddrdfz
+$ ls
+225632 bhrzzw
+269756 cqq.vrz
+$ cd ..
+$ cd ..
+$ cd trp
+$ ls
+233192 vqwngcs
+$ cd ..
+$ cd ..
+$ cd wfltm
+$ ls
+140990 djfww
+$ cd ..
+$ cd ..
+$ cd djb
+$ ls
+213191 cjwrs.prd
+dir dhvpqt
+dir gtgftm
+dir hvfvt
+208325 jwhp
+301446 qlqqmndd.zcb
+dir qnlbgvf
+dir tps
+dir zft
+dir zrtm
+dir zwnlm
+$ cd dhvpqt
+$ ls
+dir sbcj
+$ cd sbcj
+$ ls
+20611 ggt
+$ cd ..
+$ cd ..
+$ cd gtgftm
+$ ls
+179526 qcqbtmvq
+$ cd ..
+$ cd hvfvt
+$ ls
+dir djstcnrt
+dir hggpvn
+dir hvfvt
+63889 hvfvt.tjm
+265836 qlqqmndd.zcb
+105663 zft
+223582 zft.llg
+26037 zzwwg.lqh
+$ cd djstcnrt
+$ ls
+201498 hcqbmwc.gts
+139156 hpq.hgm
+277342 pshgz.rtp
+dir rjb
+257294 rqrb.lhh
+dir tqnbfnt
+313308 zft.dvc
+$ cd rjb
+$ ls
+268438 hpq.hgm
+dir hvfvt
+dir hvwpb
+161024 mzbcgqc.nvw
+137875 pwgswq.fld
+260008 pzzcww
+283261 wnvlrg.tmn
+$ cd hvfvt
+$ ls
+dir dvwqqt
+163397 hcqbmwc.gts
+265154 pwgswq.fld
+dir trsh
+dir vnf
+$ cd dvwqqt
+$ ls
+315187 hcqbmwc.gts
+$ cd ..
+$ cd trsh
+$ ls
+dir ssrdpg
+$ cd ssrdpg
+$ ls
+dir vjdc
+$ cd vjdc
+$ ls
+dir srvdrhdq
+$ cd srvdrhdq
+$ ls
+74145 djfww
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd vnf
+$ ls
+dir djfww
+$ cd djfww
+$ ls
+184018 pwgswq.fld
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd hvwpb
+$ ls
+dir jwpjrcvs
+$ cd jwpjrcvs
+$ ls
+dir cpcfcc
+$ cd cpcfcc
+$ ls
+52191 sdlv
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd tqnbfnt
+$ ls
+dir djfww
+206341 fmpb.lnp
+dir fpsjg
+4589 hcqbmwc.gts
+dir hvfvt
+8796 hvfvt.hdz
+238364 tgcdpjc.fjm
+dir zrtm
+40577 zrtm.fsr
+$ cd djfww
+$ ls
+217182 djfww.rbf
+$ cd ..
+$ cd fpsjg
+$ ls
+52456 djfww
+$ cd ..
+$ cd hvfvt
+$ ls
+dir rqhzvb
+275026 szwgzm.qjd
+dir zbmtstj
+$ cd rqhzvb
+$ ls
+8395 gcmzsd.jzf
+$ cd ..
+$ cd zbmtstj
+$ ls
+39691 qlqqmndd.zcb
+dir qqcdss
+180676 rwl.zwr
+$ cd qqcdss
+$ ls
+106297 zrtm.nsl
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd zrtm
+$ ls
+153478 ldhvt
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd hggpvn
+$ ls
+19109 cpcfcc.fbh
+249168 fnqjc
+207420 qgzsh.pfs
+135472 qlqqmndd.zcb
+$ cd ..
+$ cd hvfvt
+$ ls
+dir djfww
+213659 hcqbmwc.gts
+dir jzdwq
+204021 nvbgf
+185328 qlqqmndd.zcb
+dir zrtm
+$ cd djfww
+$ ls
+180713 rwmm.gjt
+$ cd ..
+$ cd jzdwq
+$ ls
+57424 djfww.qtm
+104960 slq.bfp
+174906 svc
+$ cd ..
+$ cd zrtm
+$ ls
+dir mrtvhht
+$ cd mrtvhht
+$ ls
+188512 djfww.fvm
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd qnlbgvf
+$ ls
+dir fjrhtssv
+46767 jhbnml.lpq
+$ cd fjrhtssv
+$ ls
+198664 fgcc
+245142 tsc.rsd
+$ cd ..
+$ cd ..
+$ cd tps
+$ ls
+dir fmlwghjv
+146731 gwch.ttr
+dir jjzmdd
+dir rtltrng
+191609 wff.mqt
+$ cd fmlwghjv
+$ ls
+189227 zrtm.vgg
+$ cd ..
+$ cd jjzmdd
+$ ls
+dir hvfvt
+178057 mpdfrrm
+49493 pwgswq.fld
+220129 sqgfb.flm
+231012 zrmsnmr
+$ cd hvfvt
+$ ls
+dir lbndbhc
+12602 mnclbss
+746 ppw
+$ cd lbndbhc
+$ ls
+49601 cdqvs.gwc
+158670 wvjpchjg
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd rtltrng
+$ ls
+dir cpgh
+115613 hvfvt
+59441 zfs
+$ cd cpgh
+$ ls
+dir djfww
+$ cd djfww
+$ ls
+dir tgt
+$ cd tgt
+$ ls
+dir vqwvqss
+$ cd vqwvqss
+$ ls
+dir bsdrhz
+$ cd bsdrhz
+$ ls
+dir pld
+$ cd pld
+$ ls
+8543 mfs.gsb
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd zft
+$ ls
+dir fhjgg
+$ cd fhjgg
+$ ls
+114494 pwgswq.fld
+$ cd ..
+$ cd ..
+$ cd zrtm
+$ ls
+201142 tlhr.rtd
+298232 wlcztszv
+$ cd ..
+$ cd zwnlm
+$ ls
+240023 hcqbmwc.gts
+159126 hpq.hgm
+22101 hvfvt.bfw
+dir ltzl
+dir mtfr
+dir sbw
+dir sqscdjlj
+dir ssf
+$ cd ltzl
+$ ls
+260692 hpq.hgm
+204540 hvfvt
+$ cd ..
+$ cd mtfr
+$ ls
+15391 pwgswq.fld
+$ cd ..
+$ cd sbw
+$ ls
+293226 hcqbmwc.gts
+267478 htllcq
+176349 nlbhcf.vpn
+286577 zft.gds
+$ cd ..
+$ cd sqscdjlj
+$ ls
+128776 gnh
+dir qbdpvcbt
+284505 qlsn.vdq
+$ cd qbdpvcbt
+$ ls
+280709 crv.hgm
+$ cd ..
+$ cd ..
+$ cd ssf
+$ ls
+13328 djfww.pjn
+19971 hvfvt
+dir zft
+$ cd zft
+$ ls
+97761 dnmnz
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd djfww
+$ ls
+109590 bwfnnf.wpd
+297297 cmht.ljg
+280726 hvfvt
+$ cd ..
+$ cd drdf
+$ ls
+56764 pwgswq.fld
+300547 wqqm
+210698 zrtm.jvq
+$ cd ..
+$ cd fgbqtjlj
+$ ls
+22217 vrmgsz.ctg
+$ cd ..
+$ cd hjsmmj
+$ ls
+232911 bcqrmp.czf
+164656 hcqbmwc.gts
+dir jql
+dir ntd
+dir prgm
+dir psfvhh
+dir zft
+$ cd jql
+$ ls
+212767 zhnhn.lzm
+dir zrtm
+$ cd zrtm
+$ ls
+35950 bcqrmp.czf
+$ cd ..
+$ cd ..
+$ cd ntd
+$ ls
+dir vml
+$ cd vml
+$ ls
+60833 bcqrmp.czf
+$ cd ..
+$ cd ..
+$ cd prgm
+$ ls
+316166 pwgswq.fld
+$ cd ..
+$ cd psfvhh
+$ ls
+152195 pwgswq.fld
+92448 qlqqmndd.zcb
+$ cd ..
+$ cd zft
+$ ls
+95808 hpq.hgm
+$ cd ..
+$ cd ..
+$ cd msptbrl
+$ ls
+256069 hpq.hgm
+$ cd ..
+$ cd slpc
+$ ls
+dir djfww
+285380 djfww.gcm
+169898 hcqbmwc.gts
+40914 mnpnhpz
+188062 pwgswq.fld
+dir zrtm
+$ cd djfww
+$ ls
+94935 pwgswq.fld
+70655 qlqqmndd.zcb
+48528 zft.qvh
+$ cd ..
+$ cd zrtm
+$ ls
+160137 hcqbmwc.gts
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd hvfvt
+$ ls
+dir cslthslv
+129407 prwq
+dir vrzfbtt
+$ cd cslthslv
+$ ls
+dir cpcfcc
+158361 hcqbmwc.gts
+$ cd cpcfcc
+$ ls
+dir zpgnczq
+$ cd zpgnczq
+$ ls
+158414 zft
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd vrzfbtt
+$ ls
+185263 nqvvl
+$ cd ..
+$ cd ..
+$ cd phwgv
+$ ls
+253690 bzpcj.fcj
+dir wtbr
+168025 zdsh.tnq
+157840 zsdfqb.zbd
+$ cd wtbr
+$ ls
+dir lvgdb
+$ cd lvgdb
+$ ls
+177751 cpcfcc.dzr
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd svw
+$ ls
+dir cpcfcc
+189430 hpq.hgm
+dir ntzbj
+13384 qlqqmndd.zcb
+10333 wdvqhwgl.trq
+161318 zwzp.jsn
+$ cd cpcfcc
+$ ls
+298999 hcqbmwc.gts
+290883 hpq.hgm
+dir qlnntp
+dir vpshs
+5547 wlrmg.bpc
+dir zft
+$ cd qlnntp
+$ ls
+168562 nqds.tqn
+$ cd ..
+$ cd vpshs
+$ ls
+246400 pwgswq.fld
+$ cd ..
+$ cd zft
+$ ls
+235634 hvfvt.hst
+$ cd ..
+$ cd ..
+$ cd ntzbj
+$ ls
+98777 qlqqmndd.zcb
+$ cd ..
+$ cd ..
+$ cd zft
+$ ls
+dir dhnzm
+299292 hvfvt.pvb
+dir ltfb
+dir mrvsjgsq
+dir ntr
+dir swmvhgd
+dir zrtm
+$ cd dhnzm
+$ ls
+267041 bbsj
+$ cd ..
+$ cd ltfb
+$ ls
+242136 bcqrmp.czf
+314862 dgdz
+203160 hcqbmwc.gts
+80422 hgvz
+dir qftjfqfv
+180815 sstl.wzg
+dir wmhm
+dir zft
+dir zszp
+$ cd qftjfqfv
+$ ls
+dir bmmw
+$ cd bmmw
+$ ls
+dir hvfvt
+318039 hvfvt.whc
+17057 pwgswq.fld
+$ cd hvfvt
+$ ls
+170348 brplf.wgv
+156783 hcqbmwc.gts
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd wmhm
+$ ls
+178474 bcqrmp.czf
+dir cmsgv
+dir dcfvrtj
+225393 htjflrs.tlm
+dir hvfvt
+dir nlrs
+273173 nsmdd.glc
+151259 pwgswq.fld
+dir ztqvwjr
+$ cd cmsgv
+$ ls
+dir flgjbjg
+$ cd flgjbjg
+$ ls
+13971 cpcfcc
+20601 qlqqmndd.zcb
+$ cd ..
+$ cd ..
+$ cd dcfvrtj
+$ ls
+141992 djfww.djn
+118149 hpq.hgm
+dir qrmqslq
+$ cd qrmqslq
+$ ls
+105940 zrtm.vql
+$ cd ..
+$ cd ..
+$ cd hvfvt
+$ ls
+181962 hpq.hgm
+$ cd ..
+$ cd nlrs
+$ ls
+82705 vnfwjf.hhl
+$ cd ..
+$ cd ztqvwjr
+$ ls
+98257 pwgswq.fld
+83864 scv.pbp
+$ cd ..
+$ cd ..
+$ cd zft
+$ ls
+183072 rsbfsl.zsj
+$ cd ..
+$ cd zszp
+$ ls
+dir hvfvt
+$ cd hvfvt
+$ ls
+dir djfww
+dir dqdtgjtg
+dir hvfvt
+$ cd djfww
+$ ls
+117037 rnmbsq.zph
+259243 zrtm.znf
+$ cd ..
+$ cd dqdtgjtg
+$ ls
+dir lrbsvng
+59301 zft
+$ cd lrbsvng
+$ ls
+46301 bcqrmp.czf
+$ cd ..
+$ cd ..
+$ cd hvfvt
+$ ls
+223277 qlqqmndd.zcb
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd mrvsjgsq
+$ ls
+160189 cpcfcc
+dir lzqf
+232626 pwgswq.fld
+dir rpmfcg
+$ cd lzqf
+$ ls
+135552 bcqrmp.czf
+48083 qlqqmndd.zcb
+dir rbg
+229086 rdswb.cjz
+204486 spbwfrwf.cmj
+$ cd rbg
+$ ls
+dir sjdwsbqq
+$ cd sjdwsbqq
+$ ls
+270621 rhv.shw
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd rpmfcg
+$ ls
+227216 bld.jtn
+dir zft
+$ cd zft
+$ ls
+43056 vzc
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ntr
+$ ls
+dir cmtnqb
+dir djfww
+195371 wffvmql.lrv
+$ cd cmtnqb
+$ ls
+135380 pbng.vhq
+$ cd ..
+$ cd djfww
+$ ls
+dir fmvrrrq
+dir mbhrbss
+dir zrtm
+$ cd fmvrrrq
+$ ls
+dir cpcfcc
+79110 djfww
+300581 ftcdj.wcc
+$ cd cpcfcc
+$ ls
+234211 zsgsm
+$ cd ..
+$ cd ..
+$ cd mbhrbss
+$ ls
+149184 djfww.gwh
+185815 rhgw.rmj
+$ cd ..
+$ cd zrtm
+$ ls
+dir zft
+$ cd zft
+$ ls
+310043 bnwvt.fbg
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd swmvhgd
+$ ls
+77547 djfww.jwr
+318547 drggg
+300962 pwgswq.fld
+$ cd ..
+$ cd zrtm
+$ ls
+229319 bflnffjj
+dir djfww
+142526 hvfvt
+232722 jprrf
+94024 ndmf.hdr
+dir vhdhn
+$ cd djfww
+$ ls
+30770 bcqrmp.czf
+$ cd ..
+$ cd vhdhn
+$ ls
+dir djfww
+48261 djfww.frg
+dir gqc
+316163 qlqqmndd.zcb
+$ cd djfww
+$ ls
+104095 cvjlthn.cfl
+223454 hgqwzh
+24715 pwgswq.fld
+283499 qlqqmndd.zcb
+dir zft
+224574 zlnwn
+$ cd zft
+$ ls
+100941 pwgswq.fld
+$ cd ..
+$ cd ..
+$ cd gqc
+$ ls
+156273 wpgwrdl

2022/day08/Makefile

@@ -0,0 +1,111 @@
+# AOC daily Makefile - GNU make only.
+#
+# Copyright (C) 2021-2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+#
+
+INPUT   := input/input.txt
+SHELL   := /bin/bash
+
+CC      := gcc
+BEAR    := bear
+CCLSFILE:= compile_commands.json
+
+LIB     := aoc_$(shell uname -m)
+INCDIR  := ../include
+LIBDIR  := ../lib
+LDFLAGS := -L$(LIBDIR)
+#LDLIB   := -l$(LIB) -lm
+LDLIB   := -l$(LIB)
+
+export LD_LIBRARY_PATH = $(LIBDIR)
+
+CFLAGS  += -std=gnu11
+CFLAGS  += -O2
+CFLAGS  += -g
+# for gprof
+# CFLAGS += -pg
+CFLAGS  += -Wall
+CFLAGS  += -Wextra
+CFLAGS  += -march=native
+# Next one may be useful for valgrind (some invalid instructions)
+# CFLAGS += -mno-tbm
+CFLAGS  += -Wmissing-declarations
+CFLAGS  += -Wno-unused-result
+
+CFLAGS  += -DDEBUG_DEBUG 	# activate general debug (debug.c)
+CFLAGS  += -DDEBUG_POOL		# memory pools management
+
+VALGRIND := valgrind
+VALGRINDFLAGS := --leak-check=full --show-leak-kinds=all --track-origins=yes \
+	--sigill-diagnostics=yes --quiet --show-error-list=yes
+
+
+TIME    := \time -f "\ttime: %E real, %U user, %S sys\n\tcontext-switch:\t%c+%w, page-faults: %F+%R\n"
+export PATH := .:$(PATH)
+
+.PHONY: clean all compile assembly memcheck memcheck1 memcheck2 part1 part2 ccls bear org
+
+all: README.org ccls part1 part2
+
+memcheck: memcheck1 memcheck2
+
+memcheck1: aoc-c
+	@$(VALGRIND) $(VALGRINDFLAGS) aoc-c -p 1 < $(INPUT)
+
+memcheck2: aoc-c
+	@$(VALGRIND) $(VALGRINDFLAGS) aoc-c -p 2 < $(INPUT)
+	@#@valgrind -s --track-origins=yes aoc-c -p 2 < $(INPUT)
+
+compile: aoc-c
+
+cpp: aoc-c.i
+
+assembly: aoc-c.s
+
+part1: aoc-c
+	@$(TIME) aoc.bash -p 1 < $(INPUT) 2>&1
+	@$(TIME) aoc-c -p 1 < $(INPUT)
+
+part2: aoc-c
+	@$(TIME) aoc.bash -p 2 < $(INPUT) 2>&1
+	@$(TIME) aoc-c -p 2 < $(INPUT)
+
+ccls: $(CCLSFILE)
+
+clean:
+	@rm -f aoc-c core* vgcore* gmon.out aoc-c.s aoc-c.i README.html compile_commands.json
+
+aoc-c: aoc-c.c common.c
+	@echo compiling $<
+	$(CC) $(CFLAGS) $(LDFLAGS) -I $(INCDIR) $^ $(LDLIB) -o $@
+
+# generate pre-processed file (.i) and assembler (.s)
+%.i: %.c
+	@echo generating $@
+	@$(CC) -E $(CFLAGS) -I $(INCDIR) $< -o $@
+
+%.s: %.c
+	@echo generating $@
+	@$(CC) -S -fverbose-asm $(CFLAGS) -I $(INCDIR) $< -o $@
+
+# generate README.org from README.html (must cleanup !)
+org: README.org
+
+%.org: %.html
+	@echo generating $@. Cleanup before commit !
+	@pandoc $< -o $@
+
+# generate compile_commands.json
+$(CCLSFILE): aoc-c.c Makefile
+	$(BEAR) -- make clean compile
+
+bear: clean
+	@touch .ccls-root
+	@$(BEAR) -- make compile

2022/day08/README.org

@@ -0,0 +1,122 @@
+** --- Day 8: Treetop Tree House ---
+The expedition comes across a peculiar patch of tall trees all planted
+carefully in a grid. The Elves explain that a previous expedition
+planted these trees as a reforestation effort. Now, they're curious if
+this would be a good location for a
+[[https://en.wikipedia.org/wiki/Tree_house][tree house]].
+
+First, determine whether there is enough tree cover here to keep a tree
+house /hidden/. To do this, you need to count the number of trees that
+are /visible from outside the grid/ when looking directly along a row or
+column.
+
+The Elves have already launched a
+[[https://en.wikipedia.org/wiki/Quadcopter][quadcopter]] to generate a
+map with the height of each tree (your puzzle input). For example:
+
+#+begin_example
+30373
+25512
+65332
+33549
+35390
+#+end_example
+
+Each tree is represented as a single digit whose value is its height,
+where =0= is the shortest and =9= is the tallest.
+
+A tree is /visible/ if all of the other trees between it and an edge of
+the grid are /shorter/ than it. Only consider trees in the same row or
+column; that is, only look up, down, left, or right from any given tree.
+
+All of the trees around the edge of the grid are /visible/ - since they
+are already on the edge, there are no trees to block the view. In this
+example, that only leaves the /interior nine trees/ to consider:
+
+- The top-left =5= is /visible/ from the left and top. (It isn't visible
+  from the right or bottom since other trees of height =5= are in the
+  way.)
+- The top-middle =5= is /visible/ from the top and right.
+- The top-right =1= is not visible from any direction; for it to be
+  visible, there would need to only be trees of height /0/ between it
+  and an edge.
+- The left-middle =5= is /visible/, but only from the right.
+- The center =3= is not visible from any direction; for it to be
+  visible, there would need to be only trees of at most height =2=
+  between it and an edge.
+- The right-middle =3= is /visible/ from the right.
+- In the bottom row, the middle =5= is /visible/, but the =3= and =4=
+  are not.
+
+With 16 trees visible on the edge and another 5 visible in the interior,
+a total of =21= trees are visible in this arrangement.
+
+Consider your map; /how many trees are visible from outside the grid?/
+
+Your puzzle answer was =1698=.
+
+** --- Part Two ---
+Content with the amount of tree cover available, the Elves just need to
+know the best spot to build their tree house: they would like to be able
+to see a lot of /trees/.
+
+To measure the viewing distance from a given tree, look up, down, left,
+and right from that tree; stop if you reach an edge or at the first tree
+that is the same height or taller than the tree under consideration. (If
+a tree is right on the edge, at least one of its viewing distances will
+be zero.)
+
+The Elves don't care about distant trees taller than those found by the
+rules above; the proposed tree house has large
+[[https://en.wikipedia.org/wiki/Eaves][eaves]] to keep it dry, so they
+wouldn't be able to see higher than the tree house anyway.
+
+In the example above, consider the middle =5= in the second row:
+
+#+begin_example
+30373
+25512
+65332
+33549
+35390
+#+end_example
+
+- Looking up, its view is not blocked; it can see =1= tree (of height
+  =3=).
+- Looking left, its view is blocked immediately; it can see only =1=
+  tree (of height =5=, right next to it).
+- Looking right, its view is not blocked; it can see =2= trees.
+- Looking down, its view is blocked eventually; it can see =2= trees
+  (one of height =3=, then the tree of height =5= that blocks its view).
+
+A tree's /scenic score/ is found by /multiplying together/ its viewing
+distance in each of the four directions. For this tree, this is =4=
+(found by multiplying =1 * 1 * 2 * 2=).
+
+However, you can do even better: consider the tree of height =5= in the
+middle of the fourth row:
+
+#+begin_example
+30373
+25512
+65332
+33549
+35390
+#+end_example
+
+- Looking up, its view is blocked at =2= trees (by another tree with a
+  height of =5=).
+- Looking left, its view is not blocked; it can see =2= trees.
+- Looking down, its view is also not blocked; it can see =1= tree.
+- Looking right, its view is blocked at =2= trees (by a massive tree of
+  height =9=).
+
+This tree's scenic score is =8= (=2 * 2 * 1 * 2=); this is the ideal
+spot for the tree house.
+
+Consider each tree on your map. /What is the highest scenic score
+possible for any tree?/
+
+Your puzzle answer was =672280=.
+
+Both parts of this puzzle are complete! They provide two gold stars: **

2022/day08/aoc-c.c

@@ -0,0 +1,159 @@
+/* aoc-c.c: Advent of Code 2022, day 8
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <string.h>
+
+#include "bits.h"
+#include "aoc.h"
+
+typedef struct tree {
+    u16 size;
+    char *h;                                      /* heigts */
+    char *v;                                      /* visible (part 1) */
+} tree_t;
+
+#define HEIGHT(t, x, y)  (((t)->h[((t)->size * (y)) + (x)]))
+#define VISIBLE(t, x, y) (((t)->v[((t)->size * (y)) + (x)]))
+
+static tree_t *parse(tree_t *trees)
+{
+    size_t alloc = 0;
+    char *buf = NULL;
+    ssize_t buflen;
+
+    buflen = getline(&buf, &alloc, stdin);
+    buf[--buflen] = 0;
+    trees->size = buflen;
+    trees->h = malloc((buflen * buflen) * sizeof(char) + 1);
+    memcpy(trees->h, buf, buflen);                   /* store first line */
+    free(buf);
+
+    for (buf = trees->h + buflen; ; buf += buflen) {
+        if (scanf("%s", buf) <= 0)
+            break;
+    }
+    trees->v = calloc(buflen * buflen, sizeof (char));
+    return trees;
+}
+
+static int visible(tree_t *t, int *max, int x, int y)
+{
+    int h = HEIGHT(t, x, y);
+    if (h > *max) {
+        VISIBLE(t, x, y) = 1;
+        if ((*max = h) == '9') {
+            return 1;
+        }
+    }
+    return 0;
+}
+
+static int check_tree(tree_t *t, int x, int y)
+{
+    int i, h = HEIGHT(t, x, y), res = 1, size = t->size, tmp;
+
+    for (tmp = 0, i = x + 1; i < size ; ++i) {    /* east */
+        tmp++;
+        if (HEIGHT(t, i, y) >= h)
+            break;
+    }
+    res *= tmp;
+    for (tmp = 0, i = x - 1; i >= 0; --i) {       /* west */
+        tmp++;
+        if (HEIGHT(t, i, y) >= h)
+            break;
+    }
+    res *= tmp;
+    for (tmp = 0, i = y + 1; i < size; ++i) {     /* south */
+        tmp++;
+        if (HEIGHT(t, x, i) >= h)
+            break;
+    }
+    res *= tmp;
+    for (tmp = 0, i = y - 1; i >= 0; --i) {       /* north */
+        tmp++;
+        if (HEIGHT(t, x, i) >= h)
+            break;
+    }
+    res *= tmp;
+    return res;
+}
+
+static int part1(tree_t *t)
+{
+    int x, y, max, res = 0, size = t->size;
+
+    for (y = 1; y < size -1; ++y) {               /* to east */
+        if ((max = HEIGHT(t, 0, y)) < '9') {
+            for (x = 1; x < size -1; ++x) {
+                if (visible (t, &max, x, y))
+                    break;
+            }
+        }
+    }
+    for (y = 1; y < size -1; ++y) {               /* to west */
+        if ((max = HEIGHT(t, size - 1, y)) < '9') {
+            for (x = size - 2; x > 0; --x) {
+                if (visible (t, &max, x, y)) {
+                    break;
+                }
+            }
+        }
+    }
+    for (x = 1; x < size -1; ++x) {             /* to south */
+        if ((max = HEIGHT(t, x, 0)) < '9') {
+            for (y = 1; y < size -1; ++y) {
+                if (visible (t, &max, x, y))
+                    break;
+            }
+        }
+    }
+    for (x = 1; x < size -1; ++x) {             /* to north */
+        if ((max = HEIGHT(t, x, size - 1)) < '9') {
+            for (y = size - 2; y > 0; --y) {
+                if (visible (t, &max, x, y))
+                    break;
+            }
+        }
+    }
+    for (y = 0; y < size; ++y)
+        for (x = 0; x < size; ++x)
+            if (VISIBLE(t, x, y))
+                res++;
+    return res + size * 4 - 4;
+}
+
+static int part2(tree_t *t)
+{
+    int res = 0, tmp, size = t->size;
+
+    for (int y = 1; y < size - 1; ++y) {
+        for (int x = 1; x < size - 1; ++x) {
+            tmp = check_tree(t, x, y);
+            if (tmp > res)
+                res = tmp;
+        }
+    }
+    return res;
+}
+
+int main(int ac, char **av)
+{
+    int part = parseargs(ac, av);
+    tree_t trees;
+
+    parse(&trees);
+    printf("%s: res=%d\n", *av, part == 1? part1(&trees): part2(&trees));
+    exit(0);
+}

2022/day08/aoc.bash

@@ -0,0 +1,135 @@
+#!/usr/bin/env bash
+#
+# aoc.bash: Advent of Code 2022, day 8
+#
+# Copyright (C) 2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+
+. common.bash
+
+declare -a trees=()                              # trees height
+declare -Ai visible=()                            # visible if set
+declare -i size
+
+parse() {
+    readarray -t trees
+    size=${#trees[@]}
+}
+
+# height - return height of a tree
+# $1: reference of return value
+# $2, $3: x, y
+# x is column, y is row
+height() {
+    local -n _ret="$1"
+    _ret=${trees[$3]:$2:1}
+}
+
+check_visible() {
+    local -n _max="$1"
+    local -i _x="$2" _y="$3" _c
+
+    height _c "$x" "y"
+    if (( _c > _max )); then
+        (( visible[$x-$y]++, _max=_c ))
+        (( _max == 9 )) && return 1
+    fi
+    return 0
+}
+
+part1() {
+    declare -ig res
+    local -i x y max
+
+    for ((y = 1; y < size -1; ++y)); do           # to east
+        height max 0 "$y"
+        (( max == 9 )) && continue
+        for ((x = 1; x < size -1; ++x)); do
+            check_visible max "$x" "$y" || break
+        done
+    done
+    for ((y = 1; y < size -1; ++y)); do           # to west
+        height max $((size - 1)) "$y"
+        (( max == 9 )) && continue
+        for ((x = size - 2; x > 0; --x)); do
+            check_visible max "$x" "$y" || break
+        done
+    done
+    for ((x = 1; x < size -1; ++x)); do           # to south
+        height max "$x" 0
+        (( max == 9 )) && continue
+        for ((y = 1; y < size -1; ++y)); do
+            check_visible max "$x" "$y" || break
+        done
+    done
+    for ((x = 1; x < size -1; ++x)); do           # to north
+        height max "$x" $((size - 1))
+        (( max == 9 )) && continue
+        for ((y = size - 2; y > 0; --y)); do
+            check_visible max "$x" "$y" || break
+        done
+    done
+    (( res = ${#visible[@]} + size * 4 - 4 ))
+}
+
+check_tree() {
+    local -n res=$1
+    local -i X="$2" Y="$3" c x y h
+    local -ai vis=()
+
+    height h "$X" "$Y"
+    for ((x = X + 1; x < size ; ++x)); do         # east
+        height c "$x" "Y"
+        (( vis[0]++ ))
+        ((c >= h)) && break
+    done
+    for ((x = X - 1; x >= 0; --x)); do            # west
+        height c "$x" "Y"
+        (( vis[1]++ ))
+        ((c >= h)) && break
+    done
+    for ((y = Y + 1; y < size; ++y)); do          # south
+        height c "$X" "$y"
+        (( vis[2]++ ))
+        ((c >= h)) && break
+    done
+    for ((y = Y - 1; y >= 0; --y)); do            # north
+        height c "$X" "$y"
+        (( vis[3]++ ))
+        ((c >= h)) && break
+    done
+    # shellcheck disable=1102
+    res=$(( "${vis[@]/%/ *}" 1))
+}
+
+
+part2() {
+    local -ig res=0
+    local -i tmp=1 x y
+
+    for ((x = 1; x < size - 1; ++x)); do
+        for ((y = 1; y < size - 1; ++y)); do
+            check_tree tmp "$x" "$y"
+            if ((tmp > res)); then
+                ((res = tmp))
+            fi
+        done
+    done
+}
+
+solve() {
+    if ((part == 1)); then
+        part1
+    else
+        part2
+    fi
+}
+
+main "$@"
+exit 0

2022/day08/aoc.h

@@ -0,0 +1,17 @@
+/* aoc.c: Advent of Code 2022
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+#ifndef _AOC_H_
+#define _AOC_H_
+
+extern int parseargs(int ac, char**av);
+
+#endif  /* _AOC_H_ */

2022/day08/common.bash

@@ -0,0 +1,68 @@
+#!/usr/bin/env bash
+#
+# common.bash: Advent of Code 2022, common bash functions
+#
+# Copyright (C) 2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+
+# shellcheck disable=2034
+export cmdname=${0##*/}
+export debug=0
+export res
+export LANG=C
+
+shopt -s extglob
+set -o noglob
+
+usage() {
+    printf "usage: %s [-d DEBUG] [-p PART]\n" "$cmdname"
+    exit 1
+}
+
+checkargs() {
+    local part=1
+    while getopts p:d: todo; do
+        case "$todo" in
+            d)
+                if [[ "$OPTARG" =~ ^[[:digit:]+]$ ]]; then
+                    debug="$OPTARG"
+                else
+                    printf "%s: illegal [%s] debug level.\n" "$CMD" "$OPTARG"
+                    exit 1
+                fi
+                ;;
+            p)
+                if [[ "$OPTARG" =~ ^[12]$ ]]; then
+                    part="$OPTARG"
+                else
+                    printf "%s: illegal [%s] part.\n" "$CMD" "$OPTARG"
+                    exit 1
+                fi
+                ;;
+            *)
+                usage
+                ;;
+        esac
+    done
+    # Now check remaining argument (backup directory)
+    shift $((OPTIND - 1))
+
+    (( $# > 1 )) && usage
+    return "$part"
+}
+
+main() {
+    local -i part
+
+    checkargs "$@"
+    part=$?
+    parse "$part"
+    solve "$part"
+    printf "%s: res=%s\n" "$cmdname" "$res"
+}

2022/day08/common.c

@@ -0,0 +1,49 @@
+/* common.c: Advent of Code 2022, common functions
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <unistd.h>
+
+#include "aoc.h"
+#include "debug.h"
+
+static int usage(char *prg)
+{
+    fprintf(stderr, "Usage: %s [-d debug_level] [-p part] [-i input]\n", prg);
+    return 1;
+}
+
+int parseargs(int ac, char **av)
+{
+    int opt, part = 1;
+
+    while ((opt = getopt(ac, av, "d:p:")) != -1) {
+        switch (opt) {
+            case 'd':
+                debug_level_set(atoi(optarg));
+                break;
+            case 'p':                             /* 1 or 2 */
+                part = atoi(optarg);
+                if (part < 1 || part > 2)
+                    return usage(*av);
+                break;
+            case 'i':
+
+            default:
+                return usage(*av);
+        }
+    }
+    if (optind < ac)
+        return usage(*av);
+    return part;
+}

2022/day08/input/example.txt

@@ -0,0 +1,5 @@
+30373
+25512
+65332
+33549
+35390

2022/day08/input/input.txt

@@ -0,0 +1,99 @@
+002100030222341303232115221524311502200403234452204125251345024423544443305142410110142101223120110
+102030322341143330244233013052025453422005415304655426206452251310214055314024034341233110302320003
+003012203404011430120134554314552441635001641050211406204621114102021543144514102510421243314102033
+330313423002034140035001210441156554545625042262651356556544202500446121455112434243313013430141203
+331203121131230002055113430244610062654034520106363462155201210355601153542301323442223310134324300
+232201231021003254355411402310326206625011564114125202263504451451212600155351424154310240411213431
+033033333301011523544023206136145505304224325606020360006206455564513553512054354124523232201230441
+132201032234334044251334220345360402456541662253556375754662323265201641514121105025300453041111234
+314322341322104402235020206565044225363527617767574524475421763504341061551154250344125514014234344
+101323043023430543342440532324326413655657527215661116623455613664321005134300223542510253102211310
+320404242514122111525043444530625417656773117247512712444315767422412130351505513231104322032421303
+221204123205133142044056245654205231734371546616753217321556472223654044043612554152141554333102034
+340310155225452152216635634352712541366312326272262143522347111166646736001360102010220214000133002
+012404003515002416422500163244271366252711531615333437352461454777311142132000140205630042305222013
+332434552302203445503543424523327464362526657251687634745536521746523154717531643250132300541053000
+020130312425316362611130462217125425435545265467725256332777233137141524314631100051153314314343032
+112115124512002346011342433146124542356845483862756322785545283652723747276776403131622540014001524
+332354013101003031053022245431274627654677343638672643442563448782737464337546541546630431125021330
+220315320142064161406534365262377268373743527784575246325564676238816733767331345114363612344051535
+102041153526000601402325625766534543527882476653366727573448727775677146365732431425225562043130034
+350054114310533002426654125166575285757827422257872378766383267543484865317252532765440216543555512
+222440404353016144747347457368562668586285847553578732435887584463446862116134751240360645225435344
+554234546163262630313431762248876668663352436888374587856263343842526635237314231451062036605442520
+525531324662660356256614344438373575732699988366775989976447384338336827686445577222030363631240512
+055541261042533424177375756738443482846986979788978997559377679255463858237757327464422026230510130
+514123221240250442457744728347386637684953574546455344754548333793233865436751231314653541223102202
+355454250661114645144551785724753237378345375493453967559796675839837444334776625552412552302431302
+202445234333206767744653874724276586973668878949653473947686567565487325864733735677672241416513452
+445415223211061633767433865252483574744685974593334963668983745643354885658423263536531213102544202
+201405464251164654177385783224666473975674643767946648464678958969336335638578275154116223152222102
+401423140356441654745572266848965593553995667644648964747884544439493545472454437715336645303346422
+154440323240741427732867467564957336394985859766644495658985963583496399736552632162756445212536404
+441663663062661372122867364584655388977474857585778686889578799644949733463423826715534215154065204
+422036122016243651174663588693898583374968974778579585977478599643389537573534354622377452555411315
+430412403362272513348763673566578945645997454758694486758844958569786758359475575577532661126532300
+503653020441267422765353469867998339764449596776968996449777464644846938866332635583727771665263026
+006252631541331635768754753357384754988659585857956567666645975599653466655333342485345762600032403
+215205542775713732868842389885585646884858449858579777975997584997463698339932263363162431251615251
+342224450731115175762626546538955447796468885776778879697695699945446388444478355347827635732006646
+045011110226211633623658548365544498466468766878699597655897586488555435934935526883851537736604133
+440352212243431376382869634434568447654566895897796875679759667598898849334873844583742271767024403
+566632367121414762272448784755746799985759966559657989697977677955455754549393784586875275341562621
+004131167135757426882464486773699786789959957795985595559587775554479945637849747667752242212324244
+022411031432724262533554794664597446479869568767598899669969588984864457535986725263473577457413134
+036415005331162527346577487593798458668976888776888766856699598847776567686579476836656723623111342
+504001302331545267684439554776894957999788577876688969865558955547965687556849786463457244355044511
+464266074264126575276833864784546697885788878967966988678696686685576789843676844576623242451411411
+660130573642326366362654785549676574587876888769689696798799988678648554635745724364273772474666502
+413511521313437652422664948645649566979966676679778669968777776786958464356797545247763267365643645
+455033174473274564484285387995879595555686569997977698868769855686564847593489668858847744131410225
+560316675532344635443349663994499869866598568889798868967976679655597494679336978524332246567265361
+121053163342234352453837754569968465557968697766766888969966667796479457384444468264837376474515455
+604062313527642634768255846899648545559665886668966887999959659769978495794795825775373713613231451
+041031112622754332842439776736966994677888699898679988967779696758849589365579766676242256227420364
+630161363126476778455475799658545955598576568877768698668579988799596866465635488284555252726211044
+455563641427127283364758796475975894658677688789777769876667978747955677573575525588444241765111511
+256420063532645225542863884958844496596759999769769687678888788875449888945958948378756476127155054
+523256165217547362636325547686549767698957967985968987897777685866576744344388256886854362647342110
+205224606764556763544234874676659474468968576879668558856675855668779847849738247387744421321145610
+022651355615653552468486676459694744747575877656886776677858584988944678787576556747724125467333305
+526313424324717126486746644643397589664468865599858886996669788566489473798387676766873216657521426
+426530404522411762572567697375959747975669667958685679878659587764977658398697353283563215312244014
+023510245741131775436864579684699874979976567776557765866775469587757498544476554753722641656303654
+211341433442225414565332887899363678699495567888998675657659688744458493387343842346747477252626250
+406543152154335614758277748595836896786654948759999978569588555764838686653647362854723163226456101
+333640633617315535456525364849458558744656899855554897897568844446533866457545654847562377442214226
+040003053246534354438748723933365934878485997458955574785966996653353969666867276761661111124104550
+405602516206264365157378627495546935658594587869579958969686766986836687348285865231616336232000100
+304131030254233641578272475868953446545577766644956989679964489688554398956223433417637732661500540
+131164662225325441733366324345477954639475997658684766465487974699579665344326248136151472051130445
+452312154206174654138684277376889449945746954689646875777596486949365968888456226732332263263420000
+003010154551246223274282454345355673349967689986885795449989359633496728553885221437611730454554455
+131435126460017635544785754344874379695379366384573934357795398633967475353836864461424146264354142
+350154544045013352533173566257757787385448697484997454578735937499665628425542376452563635450224022
+302420224365163651765264446875287359533637498445639443969586466433384346337722662774436566624454214
+415242456321105173655733744886343826548944666338683876383973497998744488687446541256724244661531431
+155303206134314124372553618623857237346567857564464797593393675563536467777317174625640132203003240
+335521544652523624641575451785635352333587957647598535633948867838652636686573137515062356442045153
+235314500244636615342325346277256685653838226755493858683465683736283367654226655456541546644313125
+252520511531061305614364671212856473625642477732845278766573642425286572562373137446456005011330433
+241525455120116046543737642325543677623243884242534423327827446383376441727657314343125403632434002
+301045223551220356167117621755325772252845222546246588464784874685774676163655131632622146412415515
+011150133311336614251435416453632383454327534367288242328746537673543714263674263262001132354544412
+314104033000306256531666256433553535833538337463847277453476563227672715617272601302551120422305504
+104211442013141664402363645617163435245556228235337864656673626354151416721375243323635625100210424
+413422313502535362615054171511431775335574748526574728747453724472157632635263350024552502052340024
+131225301023304456424150404525765416565572272321835377167235317312551645334432406536160545434122120
+342131052232413325301451041516716541737346252413667115612642227312572433104525003114240240141232002
+244421101354005430232434420344323273421374225635551363463245561271743411452116466311034334101231020
+232404402304311415164151401553463731147111147752141732625152553615361046133341313265525232544143442
+201321033520133414312301326330253041267251614477322566645472656414545035321106361434351501123314104
+211232034442524242313453325046331353174352335422752364775746537513333534355120322320404054014303124
+224032233240430510135541652065052415154147565656231651653327511443424113100543020223335130010141400
+004110101133543440511523265424013341433043655022512172622140322434116104552043413352211021312421433
+000304433232402410151205333526613043463556021413402141634154404530112303306244402221312522221004042
+200204441020135232033032541516232550445221141520665016336536052063115335040344025054213324400312303
+300211022440310123055510053251505226452265556365100101014044645236505213550201425252404100302413231
+310312413210032422053242024243343060135340422313312403505631104430120233112324204414021331012401232
+132020341330304022053503522313342026211133610000020554213662244142551253124302245242110111033101203

2022/day09/Makefile

@@ -0,0 +1,111 @@
+# AOC daily Makefile - GNU make only.
+#
+# Copyright (C) 2021-2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+#
+
+INPUT   := input/input.txt
+SHELL   := /bin/bash
+
+CC      := gcc
+BEAR    := bear
+CCLSFILE:= compile_commands.json
+
+LIB     := aoc_$(shell uname -m)
+INCDIR  := ../include
+LIBDIR  := ../lib
+LDFLAGS := -L$(LIBDIR)
+#LDLIB   := -l$(LIB) -lm
+LDLIB   := -l$(LIB)
+
+export LD_LIBRARY_PATH = $(LIBDIR)
+
+CFLAGS  += -std=gnu11
+CFLAGS  += -O2
+CFLAGS  += -g
+# for gprof
+# CFLAGS += -pg
+CFLAGS  += -Wall
+CFLAGS  += -Wextra
+CFLAGS  += -march=native
+# Next one may be useful for valgrind (some invalid instructions)
+# CFLAGS += -mno-tbm
+CFLAGS  += -Wmissing-declarations
+CFLAGS  += -Wno-unused-result
+
+CFLAGS  += -DDEBUG_DEBUG 	# activate general debug (debug.c)
+CFLAGS  += -DDEBUG_POOL		# memory pools management
+
+VALGRIND := valgrind
+VALGRINDFLAGS := --leak-check=full --show-leak-kinds=all --track-origins=yes \
+	--sigill-diagnostics=yes --quiet --show-error-list=yes
+
+
+TIME    := \time -f "\ttime: %E real, %U user, %S sys\n\tcontext-switch:\t%c+%w, page-faults: %F+%R\n"
+export PATH := .:$(PATH)
+
+.PHONY: clean all compile assembly memcheck memcheck1 memcheck2 part1 part2 ccls bear org
+
+all: README.org ccls part1 part2
+
+memcheck: memcheck1 memcheck2
+
+memcheck1: aoc-c
+	@$(VALGRIND) $(VALGRINDFLAGS) aoc-c -p 1 < $(INPUT)
+
+memcheck2: aoc-c
+	@$(VALGRIND) $(VALGRINDFLAGS) aoc-c -p 2 < $(INPUT)
+	@#@valgrind -s --track-origins=yes aoc-c -p 2 < $(INPUT)
+
+compile: aoc-c
+
+cpp: aoc-c.i
+
+assembly: aoc-c.s
+
+part1: aoc-c
+	@$(TIME) aoc.bash -p 1 < $(INPUT) 2>&1
+	@$(TIME) aoc-c -p 1 < $(INPUT)
+
+part2: aoc-c
+	@$(TIME) aoc.bash -p 2 < $(INPUT) 2>&1
+	@$(TIME) aoc-c -p 2 < $(INPUT)
+
+ccls: $(CCLSFILE)
+
+clean:
+	@rm -f aoc-c core* vgcore* gmon.out aoc-c.s aoc-c.i README.html compile_commands.json
+
+aoc-c: aoc-c.c common.c
+	@echo compiling $<
+	$(CC) $(CFLAGS) $(LDFLAGS) -I $(INCDIR) $^ $(LDLIB) -o $@
+
+# generate pre-processed file (.i) and assembler (.s)
+%.i: %.c
+	@echo generating $@
+	@$(CC) -E $(CFLAGS) -I $(INCDIR) $< -o $@
+
+%.s: %.c
+	@echo generating $@
+	@$(CC) -S -fverbose-asm $(CFLAGS) -I $(INCDIR) $< -o $@
+
+# generate README.org from README.html (must cleanup !)
+org: README.org
+
+%.org: %.html
+	@echo generating $@. Cleanup before commit !
+	@pandoc $< -o $@
+
+# generate compile_commands.json
+$(CCLSFILE): aoc-c.c Makefile
+	$(BEAR) -- make clean compile
+
+bear: clean
+	@touch .ccls-root
+	@$(BEAR) -- make compile

2022/day09/README.org

@@ -0,0 +1,747 @@
+** --- Day 9: Rope Bridge ---
+This rope bridge creaks as you walk along it. You aren't sure how old it
+is, or whether it can even support your weight.
+
+It seems to support the Elves just fine, though. The bridge spans a
+gorge which was carved out by the massive river far below you.
+
+You step carefully; as you do, the ropes stretch and twist. You decide
+to distract yourself by modeling rope physics; maybe you can even figure
+out where /not/ to step.
+
+Consider a rope with a knot at each end; these knots mark the /head/ and
+the /tail/ of the rope. If the head moves far enough away from the tail,
+the tail is pulled toward the head.
+
+Due to nebulous reasoning involving
+[[https://en.wikipedia.org/wiki/Planck_units#Planck_length][Planck
+lengths]], you should be able to model the positions of the knots on a
+two-dimensional grid. Then, by following a hypothetical /series of
+motions/ (your puzzle input) for the head, you can determine how the
+tail will move.
+
+Due to the aforementioned Planck lengths, the rope must be quite short;
+in fact, the head (=H=) and tail (=T=) must /always be touching/
+(diagonally adjacent and even overlapping both count as touching):
+
+#+begin_example
+....
+.TH.
+....
+
+....
+.H..
+..T.
+....
+
+...
+.H. (H covers T)
+...
+#+end_example
+
+If the head is ever two steps directly up, down, left, or right from the
+tail, the tail must also move one step in that direction so it remains
+close enough:
+
+#+begin_example
+.....    .....    .....
+.TH.. -> .T.H. -> ..TH.
+.....    .....    .....
+
+...    ...    ...
+.T.    .T.    ...
+.H. -> ... -> .T.
+...    .H.    .H.
+...    ...    ...
+#+end_example
+
+Otherwise, if the head and tail aren't touching and aren't in the same
+row or column, the tail always moves one step diagonally to keep up:
+
+#+begin_example
+.....    .....    .....
+.....    ..H..    ..H..
+..H.. -> ..... -> ..T..
+.T...    .T...    .....
+.....    .....    .....
+
+.....    .....    .....
+.....    .....    .....
+..H.. -> ...H. -> ..TH.
+.T...    .T...    .....
+.....    .....    .....
+#+end_example
+
+You just need to work out where the tail goes as the head follows a
+series of motions. Assume the head and the tail both start at the same
+position, overlapping.
+
+For example:
+
+#+begin_example
+R 4
+U 4
+L 3
+D 1
+R 4
+D 1
+L 5
+R 2
+#+end_example
+
+This series of motions moves the head /right/ four steps, then /up/ four
+steps, then /left/ three steps, then /down/ one step, and so on. After
+each step, you'll need to update the position of the tail if the step
+means the head is no longer adjacent to the tail. Visually, these
+motions occur as follows (=s= marks the starting position as a reference
+point):
+
+#+begin_example
+== Initial State ==
+
+......
+......
+......
+......
+H.....  (H covers T, s)
+
+== R 4 ==
+
+......
+......
+......
+......
+TH....  (T covers s)
+
+......
+......
+......
+......
+sTH...
+
+......
+......
+......
+......
+s.TH..
+
+......
+......
+......
+......
+s..TH.
+
+== U 4 ==
+
+......
+......
+......
+....H.
+s..T..
+
+......
+......
+....H.
+....T.
+s.....
+
+......
+....H.
+....T.
+......
+s.....
+
+....H.
+....T.
+......
+......
+s.....
+
+== L 3 ==
+
+...H..
+....T.
+......
+......
+s.....
+
+..HT..
+......
+......
+......
+s.....
+
+.HT...
+......
+......
+......
+s.....
+
+== D 1 ==
+
+..T...
+.H....
+......
+......
+s.....
+
+== R 4 ==
+
+..T...
+..H...
+......
+......
+s.....
+
+..T...
+...H..
+......
+......
+s.....
+
+......
+...TH.
+......
+......
+s.....
+
+......
+....TH
+......
+......
+s.....
+
+== D 1 ==
+
+......
+....T.
+.....H
+......
+s.....
+
+== L 5 ==
+
+......
+....T.
+....H.
+......
+s.....
+
+......
+....T.
+...H..
+......
+s.....
+
+......
+......
+..HT..
+......
+s.....
+
+......
+......
+.HT...
+......
+s.....
+
+......
+......
+HT....
+......
+s.....
+
+== R 2 ==
+
+......
+......
+.H....  (H covers T)
+......
+s.....
+
+......
+......
+.TH...
+......
+s.....
+#+end_example
+
+After simulating the rope, you can count up all of the positions the
+/tail visited at least once/. In this diagram, =s= again marks the
+starting position (which the tail also visited) and =#= marks other
+positions the tail visited:
+
+#+begin_example
+..##..
+...##.
+.####.
+....#.
+s###..
+#+end_example
+
+So, there are =13= positions the tail visited at least once.
+
+Simulate your complete hypothetical series of motions. /How many
+positions does the tail of the rope visit at least once?/
+
+Your puzzle answer was =5619=.
+
+** --- Part Two ---
+A rope snaps! Suddenly, the river is getting a lot closer than you
+remember. The bridge is still there, but some of the ropes that broke
+are now whipping toward you as you fall through the air!
+
+The ropes are moving too quickly to grab; you only have a few seconds to
+choose how to arch your body to avoid being hit. Fortunately, your
+simulation can be extended to support longer ropes.
+
+Rather than two knots, you now must simulate a rope consisting of /ten/
+knots. One knot is still the head of the rope and moves according to the
+series of motions. Each knot further down the rope follows the knot in
+front of it using the same rules as before.
+
+Using the same series of motions as the above example, but with the
+knots marked =H=, =1=, =2=, ..., =9=, the motions now occur as follows:
+
+#+begin_example
+== Initial State ==
+
+......
+......
+......
+......
+H.....  (H covers 1, 2, 3, 4, 5, 6, 7, 8, 9, s)
+
+== R 4 ==
+
+......
+......
+......
+......
+1H....  (1 covers 2, 3, 4, 5, 6, 7, 8, 9, s)
+
+......
+......
+......
+......
+21H...  (2 covers 3, 4, 5, 6, 7, 8, 9, s)
+
+......
+......
+......
+......
+321H..  (3 covers 4, 5, 6, 7, 8, 9, s)
+
+......
+......
+......
+......
+4321H.  (4 covers 5, 6, 7, 8, 9, s)
+
+== U 4 ==
+
+......
+......
+......
+....H.
+4321..  (4 covers 5, 6, 7, 8, 9, s)
+
+......
+......
+....H.
+.4321.
+5.....  (5 covers 6, 7, 8, 9, s)
+
+......
+....H.
+....1.
+.432..
+5.....  (5 covers 6, 7, 8, 9, s)
+
+....H.
+....1.
+..432.
+.5....
+6.....  (6 covers 7, 8, 9, s)
+
+== L 3 ==
+
+...H..
+....1.
+..432.
+.5....
+6.....  (6 covers 7, 8, 9, s)
+
+..H1..
+...2..
+..43..
+.5....
+6.....  (6 covers 7, 8, 9, s)
+
+.H1...
+...2..
+..43..
+.5....
+6.....  (6 covers 7, 8, 9, s)
+
+== D 1 ==
+
+..1...
+.H.2..
+..43..
+.5....
+6.....  (6 covers 7, 8, 9, s)
+
+== R 4 ==
+
+..1...
+..H2..
+..43..
+.5....
+6.....  (6 covers 7, 8, 9, s)
+
+..1...
+...H..  (H covers 2)
+..43..
+.5....
+6.....  (6 covers 7, 8, 9, s)
+
+......
+...1H.  (1 covers 2)
+..43..
+.5....
+6.....  (6 covers 7, 8, 9, s)
+
+......
+...21H
+..43..
+.5....
+6.....  (6 covers 7, 8, 9, s)
+
+== D 1 ==
+
+......
+...21.
+..43.H
+.5....
+6.....  (6 covers 7, 8, 9, s)
+
+== L 5 ==
+
+......
+...21.
+..43H.
+.5....
+6.....  (6 covers 7, 8, 9, s)
+
+......
+...21.
+..4H..  (H covers 3)
+.5....
+6.....  (6 covers 7, 8, 9, s)
+
+......
+...2..
+..H1..  (H covers 4; 1 covers 3)
+.5....
+6.....  (6 covers 7, 8, 9, s)
+
+......
+...2..
+.H13..  (1 covers 4)
+.5....
+6.....  (6 covers 7, 8, 9, s)
+
+......
+......
+H123..  (2 covers 4)
+.5....
+6.....  (6 covers 7, 8, 9, s)
+
+== R 2 ==
+
+......
+......
+.H23..  (H covers 1; 2 covers 4)
+.5....
+6.....  (6 covers 7, 8, 9, s)
+
+......
+......
+.1H3..  (H covers 2, 4)
+.5....
+6.....  (6 covers 7, 8, 9, s)
+#+end_example
+
+Now, you need to keep track of the positions the new tail, =9=, visits.
+In this example, the tail never moves, and so it only visits =1=
+position. However, /be careful/: more types of motion are possible than
+before, so you might want to visually compare your simulated rope to the
+one above.
+
+Here's a larger example:
+
+#+begin_example
+R 5
+U 8
+L 8
+D 3
+R 17
+D 10
+L 25
+U 20
+#+end_example
+
+These motions occur as follows (individual steps are not shown):
+
+#+begin_example
+== Initial State ==
+
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+...........H..............  (H covers 1, 2, 3, 4, 5, 6, 7, 8, 9, s)
+..........................
+..........................
+..........................
+..........................
+..........................
+
+== R 5 ==
+
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+...........54321H.........  (5 covers 6, 7, 8, 9, s)
+..........................
+..........................
+..........................
+..........................
+..........................
+
+== U 8 ==
+
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+................H.........
+................1.........
+................2.........
+................3.........
+...............54.........
+..............6...........
+.............7............
+............8.............
+...........9..............  (9 covers s)
+..........................
+..........................
+..........................
+..........................
+..........................
+
+== L 8 ==
+
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+........H1234.............
+............5.............
+............6.............
+............7.............
+............8.............
+............9.............
+..........................
+..........................
+...........s..............
+..........................
+..........................
+..........................
+..........................
+..........................
+
+== D 3 ==
+
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+.........2345.............
+........1...6.............
+........H...7.............
+............8.............
+............9.............
+..........................
+..........................
+...........s..............
+..........................
+..........................
+..........................
+..........................
+..........................
+
+== R 17 ==
+
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+................987654321H
+..........................
+..........................
+..........................
+..........................
+...........s..............
+..........................
+..........................
+..........................
+..........................
+..........................
+
+== D 10 ==
+
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+...........s.........98765
+.........................4
+.........................3
+.........................2
+.........................1
+.........................H
+
+== L 25 ==
+
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+...........s..............
+..........................
+..........................
+..........................
+..........................
+H123456789................
+
+== U 20 ==
+
+H.........................
+1.........................
+2.........................
+3.........................
+4.........................
+5.........................
+6.........................
+7.........................
+8.........................
+9.........................
+..........................
+..........................
+..........................
+..........................
+..........................
+...........s..............
+..........................
+..........................
+..........................
+..........................
+..........................
+#+end_example
+
+Now, the tail (=9=) visits =36= positions (including =s=) at least once:
+
+#+begin_example
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+..........................
+#.........................
+#.............###.........
+#............#...#........
+.#..........#.....#.......
+..#..........#.....#......
+...#........#.......#.....
+....#......s.........#....
+.....#..............#.....
+......#............#......
+.......#..........#.......
+........#........#........
+.........########.........
+#+end_example
+
+Simulate your complete series of motions on a larger rope with ten
+knots. /How many positions does the tail of the rope visit at least
+once?/
+
+Your puzzle answer was =2376=.
+
+Both parts of this puzzle are complete! They provide two gold stars: **

2022/day09/aoc-c.c

@@ -0,0 +1,200 @@
+/* aoc-c.c: Advent of Code 2022, day 9
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <string.h>
+
+#include "aoc.h"
+
+#include "br.h"
+#include "debug.h"
+#include "pool.h"
+#include "list.h"
+#include "hashtable.h"
+#include "pjwhash-inline.h"
+
+#define HBITS 12                                   /* 12 bits: 4096 buckets */
+
+typedef struct pos {
+    int x;
+    int y;
+} pos_t;
+
+typedef struct visited {
+    uint hash;
+    pos_t coord;
+    short nvisits;
+    struct hlist_node hlist;
+} visited_t;
+
+enum dir {
+    D = 'D',
+    L = 'L',
+    R = 'R',
+    U = 'U'
+};
+
+typedef struct move {
+    enum dir dir;
+    int nmoves;
+    struct list_head list;
+} move_t;
+
+DEFINE_HASHTABLE(h_visited, HBITS);
+LIST_HEAD(moves);
+
+static pool_t *pool_visited;
+static pool_t *pool_move;
+
+/**
+ * find_visited - find entry in an hashtable bucket
+ */
+static visited_t *find_visited(struct hlist_head *bucket, uint hash, pos_t *pos)
+{
+    visited_t *cur;
+
+    hlist_for_each_entry(cur, bucket, hlist)
+        if (cur->hash == hash && cur->coord.x == pos->x && cur->coord.y == pos->y)
+            return cur;
+    return NULL;
+}
+
+
+static visited_t *add_visited(pos_t *pos, uint hash, uint bucket)
+{
+    visited_t *new = pool_get(pool_visited);
+
+    new->hash = hash;
+    new->coord.x = pos->x;
+    new->coord.y = pos->y;
+    hlist_add_head(&new->hlist, &h_visited[bucket]);
+    return new;
+}
+
+static int add_visited_maybe(pos_t *pos)
+{
+    uint hash = pjwhash(pos, sizeof (*pos));
+    uint bucket = hash_32(hash, HBITS);
+    if (! find_visited(h_visited + bucket, hash, pos)) {
+        add_visited(pos, hash, bucket);
+        return 1;
+    }
+    return 0;
+}
+
+static int move_tails(pos_t *pos, int ntails)
+{
+    int i;
+    pos_t *cur, *next;
+    int didmove = 1;
+
+    for (i = 0; i < ntails && didmove; ++i) {
+        didmove = 0;
+        pos_t diff;
+        cur = pos + i;
+        next = cur + 1;
+        diff.x = cur->x - next->x;
+        diff.y = cur->y - next->y;
+        if (abs(diff.x) > 1 || abs(diff.y) > 1) { /* do move */
+            if (diff.x)
+                next->x += diff.x / abs(diff.x);
+            if (diff.y)
+                next->y += diff.y / abs(diff.y);
+            didmove = 1;
+        }
+    }
+    return didmove? add_visited_maybe(pos+ntails): 0;
+}
+
+static void move_head(pos_t *pos, move_t *move)
+{
+    log_f(3, "(%d,%d,%c) -> ", pos->x, pos->y, move->dir);
+    switch (move->dir) {
+        case U:
+            pos->y++;
+            break;
+        case R:
+            pos->x++;
+            break;
+        case D:
+            pos->y--;
+            break;
+        case L:
+            pos->x--;
+            break;
+        default:
+            log(3, "ERR=%x ", move->dir);
+    }
+    log_f(3, "(%d,%d)\n", pos->x, pos->y);
+}
+
+static pos_t *part1(int *ntails)
+{
+    static pos_t nodes[] = { [0 ... 1] = {.x = 0, .y = 0}};
+    *ntails = ARRAY_SIZE(nodes) - 1;
+    return nodes;
+}
+
+static pos_t *part2(int *ntails)
+{
+    static pos_t nodes[] = { [0 ... 9] = {.x = 0, .y = 0}};
+    *ntails = ARRAY_SIZE(nodes) - 1;
+    return nodes;
+}
+
+static int solve(int part)
+{
+    int ntails;
+    pos_t *nodes = part == 1? part1(&ntails): part2(&ntails);
+    move_t *move;
+    int res = 1;                                  /* for (0,0) */
+
+    add_visited_maybe( &(pos_t) {0, 0});
+    list_for_each_entry(move, &moves, list) {
+        for (int i = 0; i < move->nmoves; ++i) {
+            move_head(nodes, move);
+            res += move_tails(nodes, ntails);
+        }
+    }
+    return res;
+}
+
+static int parse()
+{
+    char dir;
+    int nmoves;
+    int count = 0;
+    move_t *move;
+
+    while (scanf(" %c %d", &dir, &nmoves) == 2) {
+        move = pool_get(pool_move);
+        move->dir = dir;
+        move->nmoves = nmoves;
+        list_add_tail(&move->list, &moves);
+        count++;
+    }
+    return count;
+}
+
+int main(int ac, char **av)
+{
+    int part = parseargs(ac, av);
+    pool_visited = pool_create("visited", 128, sizeof(visited_t));
+    pool_move = pool_create("dirs", 128, sizeof(move_t));
+
+    parse();
+    printf("%s: res=%d\n", *av, solve(part));
+    pool_destroy(pool_visited);
+    pool_destroy(pool_move);
+    exit(0);
+}

2022/day09/aoc.bash

@@ -0,0 +1,63 @@
+#!/usr/bin/env bash
+#
+# aoc.bash: Advent of Code 2022, day 9
+#
+# Copyright (C) 2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+
+. common.bash
+
+declare -a h{0..10}                               # h0 is head
+declare -A visited=()                             # keep count of visited
+declare -i last=1                                 # tail (last knot)
+
+move() {
+    local -i _dx="$1" _dy="$2" _m="$3" _i _n
+    local -i __dx __dy __sx __sy
+    local -n _l="h$last"
+
+    for ((_i = 0; _i < _m; ++_i)); do             # for each move
+        (( h0[0] += _dx, h0[1] += _dy ))          # head move
+        for (( _n = 0; _n < last; ++_n )); do     # for each other node
+            local -n _h="h$_n" _t="h$((_n+1))"
+            (( __dx = _h[0] - _t[0], __dy = _h[1] - _t[1] ))
+            (( __sx = __dx? __dx > 0? 1: -1 : 0 ))
+            (( __sy = __dy? __dy > 0? 1: -1 : 0 ))
+            if (( __sx * __dx > 1 || __sy * __dy > 1)); then
+                (( _t[0] += __sx ))
+                (( _t[1] += __sy ))
+            fi
+        done
+        visited["${_l[0]}"/"${_l[1]}"]=1
+    done
+}
+
+parse() {
+    local dir moves dx dy
+
+    (( $1 == 2)) && last=9
+    while read -r dir moves; do
+        dx=0
+        dy=0
+        case "$dir" in
+            L) dx=-1 ;;
+            R) dx=1 ;;
+            U) dy=1 ;;
+            D) dy=-1 ;;
+        esac
+        move "$dx" "$dy" "$moves"
+    done
+}
+
+solve() {
+    res=${#visited[@]}
+}
+
+main "$@"
+exit 0

2022/day09/aoc.h

@@ -0,0 +1,17 @@
+/* aoc.c: Advent of Code 2022
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+#ifndef _AOC_H_
+#define _AOC_H_
+
+extern int parseargs(int ac, char**av);
+
+#endif  /* _AOC_H_ */

2022/day09/common.bash

@@ -0,0 +1,68 @@
+#!/usr/bin/env bash
+#
+# common.bash: Advent of Code 2022, common bash functions
+#
+# Copyright (C) 2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+
+# shellcheck disable=2034
+export cmdname=${0##*/}
+export debug=0
+export res
+export LANG=C
+
+shopt -s extglob
+set -o noglob
+
+usage() {
+    printf "usage: %s [-d DEBUG] [-p PART]\n" "$cmdname"
+    exit 1
+}
+
+checkargs() {
+    local part=1
+    while getopts p:d: todo; do
+        case "$todo" in
+            d)
+                if [[ "$OPTARG" =~ ^[[:digit:]+]$ ]]; then
+                    debug="$OPTARG"
+                else
+                    printf "%s: illegal [%s] debug level.\n" "$CMD" "$OPTARG"
+                    exit 1
+                fi
+                ;;
+            p)
+                if [[ "$OPTARG" =~ ^[12]$ ]]; then
+                    part="$OPTARG"
+                else
+                    printf "%s: illegal [%s] part.\n" "$CMD" "$OPTARG"
+                    exit 1
+                fi
+                ;;
+            *)
+                usage
+                ;;
+        esac
+    done
+    # Now check remaining argument (backup directory)
+    shift $((OPTIND - 1))
+
+    (( $# > 1 )) && usage
+    return "$part"
+}
+
+main() {
+    local -i part
+
+    checkargs "$@"
+    part=$?
+    parse "$part"
+    solve "$part"
+    printf "%s: res=%s\n" "$cmdname" "$res"
+}

2022/day09/common.c

@@ -0,0 +1,49 @@
+/* common.c: Advent of Code 2022, common functions
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <unistd.h>
+
+#include "aoc.h"
+#include "debug.h"
+
+static int usage(char *prg)
+{
+    fprintf(stderr, "Usage: %s [-d debug_level] [-p part] [-i input]\n", prg);
+    return 1;
+}
+
+int parseargs(int ac, char **av)
+{
+    int opt, part = 1;
+
+    while ((opt = getopt(ac, av, "d:p:")) != -1) {
+        switch (opt) {
+            case 'd':
+                debug_level_set(atoi(optarg));
+                break;
+            case 'p':                             /* 1 or 2 */
+                part = atoi(optarg);
+                if (part < 1 || part > 2)
+                    return usage(*av);
+                break;
+            case 'i':
+
+            default:
+                return usage(*av);
+        }
+    }
+    if (optind < ac)
+        return usage(*av);
+    return part;
+}

2022/day09/input/example.txt

@@ -0,0 +1,8 @@
+R 4
+U 4
+L 3
+D 1
+R 4
+D 1
+L 5
+R 2

2022/day09/input/example2.txt

@@ -0,0 +1,8 @@
+R 5
+U 8
+L 8
+D 3
+R 17
+D 10
+L 25
+U 20

2022/day10/Makefile

@@ -0,0 +1,111 @@
+# AOC daily Makefile - GNU make only.
+#
+# Copyright (C) 2021-2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+#
+
+INPUT   := input/input.txt
+SHELL   := /bin/bash
+
+CC      := gcc
+BEAR    := bear
+CCLSFILE:= compile_commands.json
+
+LIB     := aoc_$(shell uname -m)
+INCDIR  := ../include
+LIBDIR  := ../lib
+LDFLAGS := -L$(LIBDIR)
+#LDLIB   := -l$(LIB) -lm
+LDLIB   := -l$(LIB)
+
+export LD_LIBRARY_PATH = $(LIBDIR)
+
+CFLAGS  += -std=gnu11
+CFLAGS  += -O2
+CFLAGS  += -g
+# for gprof
+# CFLAGS += -pg
+CFLAGS  += -Wall
+CFLAGS  += -Wextra
+CFLAGS  += -march=native
+# Next one may be useful for valgrind (some invalid instructions)
+# CFLAGS += -mno-tbm
+CFLAGS  += -Wmissing-declarations
+CFLAGS  += -Wno-unused-result
+
+CFLAGS  += -DDEBUG_DEBUG 	# activate general debug (debug.c)
+CFLAGS  += -DDEBUG_POOL		# memory pools management
+
+VALGRIND := valgrind
+VALGRINDFLAGS := --leak-check=full --show-leak-kinds=all --track-origins=yes \
+	--sigill-diagnostics=yes --quiet --show-error-list=yes
+
+
+TIME    := \time -f "\ttime: %E real, %U user, %S sys\n\tcontext-switch:\t%c+%w, page-faults: %F+%R\n"
+export PATH := .:$(PATH)
+
+.PHONY: clean all compile assembly memcheck memcheck1 memcheck2 part1 part2 ccls bear org
+
+all: README.org ccls part1 part2
+
+memcheck: memcheck1 memcheck2
+
+memcheck1: aoc-c
+	@$(VALGRIND) $(VALGRINDFLAGS) aoc-c -p 1 < $(INPUT)
+
+memcheck2: aoc-c
+	@$(VALGRIND) $(VALGRINDFLAGS) aoc-c -p 2 < $(INPUT)
+	@#@valgrind -s --track-origins=yes aoc-c -p 2 < $(INPUT)
+
+compile: aoc-c
+
+cpp: aoc-c.i
+
+assembly: aoc-c.s
+
+part1: aoc-c
+	@$(TIME) aoc.bash -p 1 < $(INPUT) 2>&1
+	@$(TIME) aoc-c -p 1 < $(INPUT)
+
+part2: aoc-c
+	@$(TIME) aoc.bash -p 2 < $(INPUT) 2>&1
+	@$(TIME) aoc-c -p 2 < $(INPUT)
+
+ccls: $(CCLSFILE)
+
+clean:
+	@rm -f aoc-c core* vgcore* gmon.out aoc-c.s aoc-c.i README.html compile_commands.json
+
+aoc-c: aoc-c.c common.c
+	@echo compiling $<
+	$(CC) $(CFLAGS) $(LDFLAGS) -I $(INCDIR) $^ $(LDLIB) -o $@
+
+# generate pre-processed file (.i) and assembler (.s)
+%.i: %.c
+	@echo generating $@
+	@$(CC) -E $(CFLAGS) -I $(INCDIR) $< -o $@
+
+%.s: %.c
+	@echo generating $@
+	@$(CC) -S -fverbose-asm $(CFLAGS) -I $(INCDIR) $< -o $@
+
+# generate README.org from README.html (must cleanup !)
+org: README.org
+
+%.org: %.html
+	@echo generating $@. Cleanup before commit !
+	@pandoc $< -o $@
+
+# generate compile_commands.json
+$(CCLSFILE): aoc-c.c Makefile
+	$(BEAR) -- make clean compile
+
+bear: clean
+	@touch .ccls-root
+	@$(BEAR) -- make compile

2022/day10/README.org

@@ -0,0 +1,389 @@
+** --- Day 10: Cathode-Ray Tube ---
+You avoid the ropes, plunge into the river, and swim to shore.
+
+The Elves yell something about meeting back up with them upriver, but
+the river is too loud to tell exactly what they're saying. They finish
+crossing the bridge and disappear from view.
+
+Situations like this must be why the Elves prioritized getting the
+communication system on your handheld device working. You pull it out of
+your pack, but the amount of water slowly draining from a big crack in
+its screen tells you it probably won't be of much immediate use.
+
+/Unless/, that is, you can design a replacement for the device's video
+system! It seems to be some kind of
+[[https://en.wikipedia.org/wiki/Cathode-ray_tube][cathode-ray tube]]
+screen and simple CPU that are both driven by a precise /clock circuit/.
+The clock circuit ticks at a constant rate; each tick is called a
+/cycle/.
+
+Start by figuring out the signal being sent by the CPU. The CPU has a
+single register, =X=, which starts with the value =1=. It supports only
+two instructions:
+
+- =addx V= takes /two cycles/ to complete. /After/ two cycles, the =X=
+  register is increased by the value =V=. (=V= can be negative.)
+- =noop= takes /one cycle/ to complete. It has no other effect.
+
+The CPU uses these instructions in a program (your puzzle input) to,
+somehow, tell the screen what to draw.
+
+Consider the following small program:
+
+#+begin_example
+noop
+addx 3
+addx -5
+#+end_example
+
+Execution of this program proceeds as follows:
+
+- At the start of the first cycle, the =noop= instruction begins
+  execution. During the first cycle, =X= is =1=. After the first cycle,
+  the =noop= instruction finishes execution, doing nothing.
+- At the start of the second cycle, the =addx 3= instruction begins
+  execution. During the second cycle, =X= is still =1=.
+- During the third cycle, =X= is still =1=. After the third cycle, the
+  =addx 3= instruction finishes execution, setting =X= to =4=.
+- At the start of the fourth cycle, the =addx -5= instruction begins
+  execution. During the fourth cycle, =X= is still =4=.
+- During the fifth cycle, =X= is still =4=. After the fifth cycle, the
+  =addx -5= instruction finishes execution, setting =X= to =-1=.
+
+Maybe you can learn something by looking at the value of the =X=
+register throughout execution. For now, consider the /signal strength/
+(the cycle number multiplied by the value of the =X= register) /during/
+the 20th cycle and every 40 cycles after that (that is, during the 20th,
+60th, 100th, 140th, 180th, and 220th cycles).
+
+For example, consider this larger program:
+
+#+begin_example
+addx 15
+addx -11
+addx 6
+addx -3
+addx 5
+addx -1
+addx -8
+addx 13
+addx 4
+noop
+addx -1
+addx 5
+addx -1
+addx 5
+addx -1
+addx 5
+addx -1
+addx 5
+addx -1
+addx -35
+addx 1
+addx 24
+addx -19
+addx 1
+addx 16
+addx -11
+noop
+noop
+addx 21
+addx -15
+noop
+noop
+addx -3
+addx 9
+addx 1
+addx -3
+addx 8
+addx 1
+addx 5
+noop
+noop
+noop
+noop
+noop
+addx -36
+noop
+addx 1
+addx 7
+noop
+noop
+noop
+addx 2
+addx 6
+noop
+noop
+noop
+noop
+noop
+addx 1
+noop
+noop
+addx 7
+addx 1
+noop
+addx -13
+addx 13
+addx 7
+noop
+addx 1
+addx -33
+noop
+noop
+noop
+addx 2
+noop
+noop
+noop
+addx 8
+noop
+addx -1
+addx 2
+addx 1
+noop
+addx 17
+addx -9
+addx 1
+addx 1
+addx -3
+addx 11
+noop
+noop
+addx 1
+noop
+addx 1
+noop
+noop
+addx -13
+addx -19
+addx 1
+addx 3
+addx 26
+addx -30
+addx 12
+addx -1
+addx 3
+addx 1
+noop
+noop
+noop
+addx -9
+addx 18
+addx 1
+addx 2
+noop
+noop
+addx 9
+noop
+noop
+noop
+addx -1
+addx 2
+addx -37
+addx 1
+addx 3
+noop
+addx 15
+addx -21
+addx 22
+addx -6
+addx 1
+noop
+addx 2
+addx 1
+noop
+addx -10
+noop
+noop
+addx 20
+addx 1
+addx 2
+addx 2
+addx -6
+addx -11
+noop
+noop
+noop
+#+end_example
+
+The interesting signal strengths can be determined as follows:
+
+- During the 20th cycle, register =X= has the value =21=, so the signal
+  strength is 20 * 21 = /420/. (The 20th cycle occurs in the middle of
+  the second =addx -1=, so the value of register =X= is the starting
+  value, =1=, plus all of the other =addx= values up to that point: 1 +
+  15 - 11 + 6 - 3 + 5 - 1 - 8 + 13 + 4 = 21.)
+- During the 60th cycle, register =X= has the value =19=, so the signal
+  strength is 60 * 19 = =1140=.
+- During the 100th cycle, register =X= has the value =18=, so the signal
+  strength is 100 * 18 = =1800=.
+- During the 140th cycle, register =X= has the value =21=, so the signal
+  strength is 140 * 21 = =2940=.
+- During the 180th cycle, register =X= has the value =16=, so the signal
+  strength is 180 * 16 = =2880=.
+- During the 220th cycle, register =X= has the value =18=, so the signal
+  strength is 220 * 18 = =3960=.
+
+The sum of these signal strengths is =13140=.
+
+Find the signal strength during the 20th, 60th, 100th, 140th, 180th, and
+220th cycles. /What is the sum of these six signal strengths?/
+
+Your puzzle answer was =13220=.
+
+** --- Part Two ---
+It seems like the =X= register controls the horizontal position of a
+[[https://en.wikipedia.org/wiki/Sprite_(computer_graphics)][sprite]].
+Specifically, the sprite is 3 pixels wide, and the =X= register sets the
+horizontal position of the /middle/ of that sprite. (In this system,
+there is no such thing as "vertical position": if the sprite's
+horizontal position puts its pixels where the CRT is currently drawing,
+then those pixels will be drawn.)
+
+You count the pixels on the CRT: 40 wide and 6 high. This CRT screen
+draws the top row of pixels left-to-right, then the row below that, and
+so on. The left-most pixel in each row is in position =0=, and the
+right-most pixel in each row is in position =39=.
+
+Like the CPU, the CRT is tied closely to the clock circuit: the CRT
+draws /a single pixel during each cycle/. Representing each pixel of the
+screen as a =#=, here are the cycles during which the first and last
+pixel in each row are drawn:
+
+#+begin_example
+Cycle   1 -> ######################################## <- Cycle  40
+Cycle  41 -> ######################################## <- Cycle  80
+Cycle  81 -> ######################################## <- Cycle 120
+Cycle 121 -> ######################################## <- Cycle 160
+Cycle 161 -> ######################################## <- Cycle 200
+Cycle 201 -> ######################################## <- Cycle 240
+#+end_example
+
+So, by [[https://en.wikipedia.org/wiki/Racing_the_Beam][carefully]]
+[[https://www.youtube.com/watch?v=sJFnWZH5FXc][timing]] the CPU
+instructions and the CRT drawing operations, you should be able to
+determine whether the sprite is visible the instant each pixel is drawn.
+If the sprite is positioned such that one of its three pixels is the
+pixel currently being drawn, the screen produces a /lit/ pixel (=#=);
+otherwise, the screen leaves the pixel /dark/ (=.=).
+
+The first few pixels from the larger example above are drawn as follows:
+
+#+begin_example
+Sprite position: ###.....................................
+
+Start cycle   1: begin executing addx 15
+During cycle  1: CRT draws pixel in position 0
+Current CRT row: #
+
+During cycle  2: CRT draws pixel in position 1
+Current CRT row: ##
+End of cycle  2: finish executing addx 15 (Register X is now 16)
+Sprite position: ...............###......................
+
+Start cycle   3: begin executing addx -11
+During cycle  3: CRT draws pixel in position 2
+Current CRT row: ##.
+
+During cycle  4: CRT draws pixel in position 3
+Current CRT row: ##..
+End of cycle  4: finish executing addx -11 (Register X is now 5)
+Sprite position: ....###.................................
+
+Start cycle   5: begin executing addx 6
+During cycle  5: CRT draws pixel in position 4
+Current CRT row: ##..#
+
+During cycle  6: CRT draws pixel in position 5
+Current CRT row: ##..##
+End of cycle  6: finish executing addx 6 (Register X is now 11)
+Sprite position: ..........###...........................
+
+Start cycle   7: begin executing addx -3
+During cycle  7: CRT draws pixel in position 6
+Current CRT row: ##..##.
+
+During cycle  8: CRT draws pixel in position 7
+Current CRT row: ##..##..
+End of cycle  8: finish executing addx -3 (Register X is now 8)
+Sprite position: .......###..............................
+
+Start cycle   9: begin executing addx 5
+During cycle  9: CRT draws pixel in position 8
+Current CRT row: ##..##..#
+
+During cycle 10: CRT draws pixel in position 9
+Current CRT row: ##..##..##
+End of cycle 10: finish executing addx 5 (Register X is now 13)
+Sprite position: ............###.........................
+
+Start cycle  11: begin executing addx -1
+During cycle 11: CRT draws pixel in position 10
+Current CRT row: ##..##..##.
+
+During cycle 12: CRT draws pixel in position 11
+Current CRT row: ##..##..##..
+End of cycle 12: finish executing addx -1 (Register X is now 12)
+Sprite position: ...........###..........................
+
+Start cycle  13: begin executing addx -8
+During cycle 13: CRT draws pixel in position 12
+Current CRT row: ##..##..##..#
+
+During cycle 14: CRT draws pixel in position 13
+Current CRT row: ##..##..##..##
+End of cycle 14: finish executing addx -8 (Register X is now 4)
+Sprite position: ...###..................................
+
+Start cycle  15: begin executing addx 13
+During cycle 15: CRT draws pixel in position 14
+Current CRT row: ##..##..##..##.
+
+During cycle 16: CRT draws pixel in position 15
+Current CRT row: ##..##..##..##..
+End of cycle 16: finish executing addx 13 (Register X is now 17)
+Sprite position: ................###.....................
+
+Start cycle  17: begin executing addx 4
+During cycle 17: CRT draws pixel in position 16
+Current CRT row: ##..##..##..##..#
+
+During cycle 18: CRT draws pixel in position 17
+Current CRT row: ##..##..##..##..##
+End of cycle 18: finish executing addx 4 (Register X is now 21)
+Sprite position: ....................###.................
+
+Start cycle  19: begin executing noop
+During cycle 19: CRT draws pixel in position 18
+Current CRT row: ##..##..##..##..##.
+End of cycle 19: finish executing noop
+
+Start cycle  20: begin executing addx -1
+During cycle 20: CRT draws pixel in position 19
+Current CRT row: ##..##..##..##..##..
+
+During cycle 21: CRT draws pixel in position 20
+Current CRT row: ##..##..##..##..##..#
+End of cycle 21: finish executing addx -1 (Register X is now 20)
+Sprite position: ...................###..................
+#+end_example
+
+Allowing the program to run to completion causes the CRT to produce the
+following image:
+
+#+begin_example
+##..##..##..##..##..##..##..##..##..##..
+###...###...###...###...###...###...###.
+####....####....####....####....####....
+#####.....#####.....#####.....#####.....
+######......######......######......####
+#######.......#######.......#######.....
+#+end_example
+
+Render the image given by your program. /What eight capital letters
+appear on your CRT?/
+
+Your puzzle answer was =RUAKHBEK=.
+
+Both parts of this puzzle are complete! They provide two gold stars: **

2022/day10/aoc-c.c

@@ -0,0 +1,167 @@
+/* aoc-c.c: Advent of Code 2022, day 10
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <string.h>
+
+#include "br.h"
+#include "debug.h"
+
+#include "aoc.h"
+
+#define MAXARGS 1                                 /* max arguments to opcode */
+
+typedef enum opcode {                             /* available opcodes */
+    ERR  = -1,
+    NOOP =  0,
+    ADDX
+} opcode_t;
+
+typedef struct hw {                               /* hardware */
+    int tick;                                     /* clock */
+    int regx;                                     /* x register */
+    int signal;                                   /* signal strength */
+    int alrm;                                     /* next tick signal */
+    int rearm;                                    /* rearm signal value */
+    void (* tickfct)(struct hw *hw);              /* tick function */
+    void (* alrmfct)(struct hw *hw);              /* signal function */
+    int part;                                     /* puzzle part */
+} hw_t;
+
+typedef struct op {                               /* operators indormation */
+    char *mnemo;
+    opcode_t opcode;
+    int ticks;
+    void (* fct)(hw_t *hw, int *);
+    int nargs;
+} op_t;
+
+static inline void alarm1(hw_t *hw)
+{
+    hw->signal += hw->tick * hw->regx;
+    hw->alrm = hw->rearm;
+}
+
+static inline void alarm2(hw_t *hw)
+{
+    putchar('\n');                                /* '.' fixes last column garbage */
+    hw->alrm = hw->rearm;
+}
+
+static inline void tick1(__unused hw_t *hw)
+{
+}
+
+static inline void tick2(hw_t *hw)
+{
+    int pos = abs(hw->tick % 40 - hw->regx - 1);
+    putchar(pos < 2? '#': '.');
+}
+
+static void bootstrap(hw_t *hw, int part)
+{
+    hw->tick = 0;
+    hw->regx = 1;
+    hw->signal = 0;
+    hw->alrm = part == 1? 20: 40;
+    hw->rearm = 40;
+    hw->alrmfct = part == 1?  alarm1: alarm2;
+    hw->tickfct = part == 1?  tick1: tick2;
+    hw->part = part;
+}
+
+static inline void tick(hw_t *hw)
+{
+    hw->tick++;
+    hw->alrm--;
+    hw->tickfct(hw);
+    if (!hw->alrm)
+        hw->alrmfct(hw);
+}
+
+static inline void ticks(hw_t *hw, int ticks)
+{
+    for (int i = 0; i < ticks; ++i)
+        tick(hw);
+}
+
+static void do_noop(__unused hw_t *hw, __unused int *args)
+{
+}
+
+static void do_addx(hw_t *hw, int *args)
+{
+    hw->regx += *args;
+}
+
+static op_t opcodes[] = {
+    { "noop", NOOP, 1, do_noop, 0 },
+    { "addx", ADDX, 2, do_addx, 1 }
+};
+
+#define NOPS ARRAY_SIZE(opcodes)
+
+static op_t *getop(const char *mnemo)
+{
+    for (ulong i = 0; i < NOPS; ++i)
+        if (!strcmp(mnemo, opcodes[i].mnemo))
+            return opcodes + i;
+    return NULL;
+}
+
+static int part1(hw_t *hw)
+{
+    return hw->signal;
+}
+
+static int part2(hw_t *hw)
+{
+    return hw->signal;
+}
+
+static int parse(hw_t *hw)
+{
+    size_t alloc = 0;
+    char *buf = NULL;
+    ssize_t buflen;
+    char *token;
+    op_t *op;
+    int args[MAXARGS];
+
+    while ((buflen = getline(&buf, &alloc, stdin)) > 0) {
+        buf[--buflen] = 0;
+        if ((token = strtok(buf, " "))) {
+            if ((op = getop(token))) {
+                ticks(hw, op->ticks);
+                for (int i = 0; i < op->nargs; ++i)
+                    args[i] = atoi(strtok(NULL, " "));
+                op->fct(hw, args);
+            } else {
+                fprintf(stderr, "Fatal: opcode [%s] not found\n", token);
+                exit(1);
+            }
+        }
+    }
+    return 1;
+}
+
+int main(int ac, char **av)
+{
+    int part = parseargs(ac, av);
+    hw_t hw;
+
+    bootstrap(&hw, part);
+    parse(&hw);
+    printf("%s: res=%d\n", *av, part == 1? part1(&hw): part2(&hw));
+    exit(0);
+}

2022/day10/aoc.bash

@@ -0,0 +1,67 @@
+#!/usr/bin/env bash
+#
+# aoc.bash: Advent of Code 2022, day 10
+#
+# Copyright (C) 2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+
+. common.bash
+
+declare -i cycle=0 regx=1
+
+draw() {
+    local -i pos
+
+    (( pos = cycle % 40 - regx - 1, pos = pos < 0? -pos: pos ))
+    (( pos < 2 )) && res+="#" || res+="."
+    if ! (( cycle % 40 )); then
+        res+=$'\n'
+    fi
+}
+
+tick() {
+    (( cycle ++ ))
+    if (( part == 1 )); then
+        (( (cycle + 20) % 40 )) || (( res += cycle * regx ))
+    else
+        draw
+    fi
+}
+
+do_noop() {
+    tick
+}
+
+do_add() {
+    tick
+    tick
+    (( regx += $1 ))
+}
+
+parse() {
+    while read -r instr value; do
+        # not too hacky, to prepare for next puzzles ;-)
+        case "$instr" in
+            "addx")
+                do_add "$value"
+                ;;
+            "noop")
+                do_noop
+                ;;
+        esac
+    done
+}
+
+solve() {
+    # remove last '\n', add starting '\n'
+    (( part == 2 )) && res=$'\n'${res::-1}
+}
+
+main "$@"
+exit 0

2022/day10/aoc.h

@@ -0,0 +1,17 @@
+/* aoc.c: Advent of Code 2022
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+#ifndef _AOC_H_
+#define _AOC_H_
+
+extern int parseargs(int ac, char**av);
+
+#endif  /* _AOC_H_ */

2022/day10/common.bash

@@ -0,0 +1,68 @@
+#!/usr/bin/env bash
+#
+# common.bash: Advent of Code 2022, common bash functions
+#
+# Copyright (C) 2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+
+# shellcheck disable=2034
+export cmdname=${0##*/}
+export debug=0
+export res
+export LANG=C
+
+shopt -s extglob
+set -o noglob
+
+usage() {
+    printf "usage: %s [-d DEBUG] [-p PART]\n" "$cmdname"
+    exit 1
+}
+
+checkargs() {
+    local part=1
+    while getopts p:d: todo; do
+        case "$todo" in
+            d)
+                if [[ "$OPTARG" =~ ^[[:digit:]+]$ ]]; then
+                    debug="$OPTARG"
+                else
+                    printf "%s: illegal [%s] debug level.\n" "$CMD" "$OPTARG"
+                    exit 1
+                fi
+                ;;
+            p)
+                if [[ "$OPTARG" =~ ^[12]$ ]]; then
+                    part="$OPTARG"
+                else
+                    printf "%s: illegal [%s] part.\n" "$CMD" "$OPTARG"
+                    exit 1
+                fi
+                ;;
+            *)
+                usage
+                ;;
+        esac
+    done
+    # Now check remaining argument (backup directory)
+    shift $((OPTIND - 1))
+
+    (( $# > 1 )) && usage
+    return "$part"
+}
+
+main() {
+    local -i part
+
+    checkargs "$@"
+    part=$?
+    parse "$part"
+    solve "$part"
+    printf "%s: res=%s\n" "$cmdname" "$res"
+}

2022/day10/common.c

@@ -0,0 +1,49 @@
+/* common.c: Advent of Code 2022, common functions
+ *
+ * Copyright (C) 2022 Bruno Raoult ("br")
+ * Licensed under the GNU General Public License v3.0 or later.
+ * Some rights reserved. See COPYING.
+ *
+ * You should have received a copy of the GNU General Public License along with this
+ * program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+ *
+ * SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+ */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <unistd.h>
+
+#include "aoc.h"
+#include "debug.h"
+
+static int usage(char *prg)
+{
+    fprintf(stderr, "Usage: %s [-d debug_level] [-p part] [-i input]\n", prg);
+    return 1;
+}
+
+int parseargs(int ac, char **av)
+{
+    int opt, part = 1;
+
+    while ((opt = getopt(ac, av, "d:p:")) != -1) {
+        switch (opt) {
+            case 'd':
+                debug_level_set(atoi(optarg));
+                break;
+            case 'p':                             /* 1 or 2 */
+                part = atoi(optarg);
+                if (part < 1 || part > 2)
+                    return usage(*av);
+                break;
+            case 'i':
+
+            default:
+                return usage(*av);
+        }
+    }
+    if (optind < ac)
+        return usage(*av);
+    return part;
+}

2022/day10/input/example.txt

@@ -0,0 +1,146 @@
+addx 15
+addx -11
+addx 6
+addx -3
+addx 5
+addx -1
+addx -8
+addx 13
+addx 4
+noop
+addx -1
+addx 5
+addx -1
+addx 5
+addx -1
+addx 5
+addx -1
+addx 5
+addx -1
+addx -35
+addx 1
+addx 24
+addx -19
+addx 1
+addx 16
+addx -11
+noop
+noop
+addx 21
+addx -15
+noop
+noop
+addx -3
+addx 9
+addx 1
+addx -3
+addx 8
+addx 1
+addx 5
+noop
+noop
+noop
+noop
+noop
+addx -36
+noop
+addx 1
+addx 7
+noop
+noop
+noop
+addx 2
+addx 6
+noop
+noop
+noop
+noop
+noop
+addx 1
+noop
+noop
+addx 7
+addx 1
+noop
+addx -13
+addx 13
+addx 7
+noop
+addx 1
+addx -33
+noop
+noop
+noop
+addx 2
+noop
+noop
+noop
+addx 8
+noop
+addx -1
+addx 2
+addx 1
+noop
+addx 17
+addx -9
+addx 1
+addx 1
+addx -3
+addx 11
+noop
+noop
+addx 1
+noop
+addx 1
+noop
+noop
+addx -13
+addx -19
+addx 1
+addx 3
+addx 26
+addx -30
+addx 12
+addx -1
+addx 3
+addx 1
+noop
+noop
+noop
+addx -9
+addx 18
+addx 1
+addx 2
+noop
+noop
+addx 9
+noop
+noop
+noop
+addx -1
+addx 2
+addx -37
+addx 1
+addx 3
+noop
+addx 15
+addx -21
+addx 22
+addx -6
+addx 1
+noop
+addx 2
+addx 1
+noop
+addx -10
+noop
+noop
+addx 20
+addx 1
+addx 2
+addx 2
+addx -6
+addx -11
+noop
+noop
+noop

2022/day10/input/example2.txt

@@ -0,0 +1,3 @@
+noop
+addx 3
+addx -5

2022/day10/input/input.txt

@@ -0,0 +1,137 @@
+noop
+noop
+addx 5
+addx 3
+addx -2
+noop
+addx 5
+addx 4
+noop
+addx 3
+noop
+addx 2
+addx -17
+addx 18
+addx 3
+addx 1
+noop
+addx 5
+noop
+addx 1
+addx 2
+addx 5
+addx -40
+noop
+addx 5
+addx 2
+addx 3
+noop
+addx 2
+addx 3
+addx -2
+addx 2
+addx 2
+noop
+addx 3
+addx 5
+addx 2
+addx 3
+addx -2
+addx 2
+addx -24
+addx 31
+addx 2
+addx -33
+addx -6
+addx 5
+addx 2
+addx 3
+noop
+addx 2
+addx 3
+noop
+addx 2
+addx -1
+addx 6
+noop
+noop
+addx 1
+addx 4
+noop
+noop
+addx -15
+addx 20
+noop
+addx -23
+addx 27
+noop
+addx -35
+addx 1
+noop
+noop
+addx 5
+addx 11
+addx -10
+addx 4
+addx 1
+noop
+addx 2
+addx 2
+noop
+addx 3
+noop
+addx 3
+addx 2
+noop
+addx 3
+addx 2
+addx 11
+addx -4
+addx 2
+addx -38
+addx -1
+addx 2
+noop
+addx 3
+addx 5
+addx 2
+addx -7
+addx 8
+addx 2
+addx 2
+noop
+addx 3
+addx 5
+addx 2
+addx -25
+addx 26
+addx 2
+addx 8
+addx -1
+addx 2
+addx -2
+addx -37
+addx 5
+addx 3
+addx -1
+addx 5
+noop
+addx 22
+addx -21
+addx 2
+addx 5
+addx 2
+addx 13
+addx -12
+addx 4
+noop
+noop
+addx 5
+addx 1
+noop
+noop
+addx 2
+noop
+addx 3
+noop
+noop

2022/day11/Makefile

@@ -0,0 +1,111 @@
+# AOC daily Makefile - GNU make only.
+#
+# Copyright (C) 2021-2022 Bruno Raoult ("br")
+# Licensed under the GNU General Public License v3.0 or later.
+# Some rights reserved. See COPYING.
+#
+# You should have received a copy of the GNU General Public License along with this
+# program. If not, see <https://www.gnu.org/licenses/gpl-3.0-standalone.html>.
+#
+# SPDX-License-Identifier: GPL-3.0-or-later <https://spdx.org/licenses/GPL-3.0-or-later.html>
+#
+
+INPUT   := input/input.txt
+SHELL   := /bin/bash
+
+CC      := gcc
+BEAR    := bear
+CCLSFILE:= compile_commands.json
+
+LIB     := aoc_$(shell uname -m)
+INCDIR  := ../include
+LIBDIR  := ../lib
+LDFLAGS := -L$(LIBDIR)
+#LDLIB   := -l$(LIB) -lm
+LDLIB   := -l$(LIB)
+
+export LD_LIBRARY_PATH = $(LIBDIR)
+
+CFLAGS  += -std=gnu11
+CFLAGS  += -O2
+CFLAGS  += -g
+# for gprof
+# CFLAGS += -pg
+CFLAGS  += -Wall
+CFLAGS  += -Wextra
+CFLAGS  += -march=native
+# Next one may be useful for valgrind (some invalid instructions)
+# CFLAGS += -mno-tbm
+CFLAGS  += -Wmissing-declarations
+CFLAGS  += -Wno-unused-result
+
+CFLAGS  += -DDEBUG_DEBUG 	# activate general debug (debug.c)
+CFLAGS  += -DDEBUG_POOL		# memory pools management
+
+VALGRIND := valgrind
+VALGRINDFLAGS := --leak-check=full --show-leak-kinds=all --track-origins=yes \
+	--sigill-diagnostics=yes --quiet --show-error-list=yes
+
+
+TIME    := \time -f "\ttime: %E real, %U user, %S sys\n\tcontext-switch:\t%c+%w, page-faults: %F+%R\n"
+export PATH := .:$(PATH)
+
+.PHONY: clean all compile assembly memcheck memcheck1 memcheck2 part1 part2 ccls bear org
+
+all: README.org ccls part1 part2
+
+memcheck: memcheck1 memcheck2
+
+memcheck1: aoc-c
+	@$(VALGRIND) $(VALGRINDFLAGS) aoc-c -p 1 < $(INPUT)
+
+memcheck2: aoc-c
+	@$(VALGRIND) $(VALGRINDFLAGS) aoc-c -p 2 < $(INPUT)
+	@#@valgrind -s --track-origins=yes aoc-c -p 2 < $(INPUT)
+
+compile: aoc-c
+
+cpp: aoc-c.i
+
+assembly: aoc-c.s
+
+part1: aoc-c
+	@$(TIME) aoc.bash -p 1 < $(INPUT) 2>&1
+	@$(TIME) aoc-c -p 1 < $(INPUT)
+
+part2: aoc-c
+	@$(TIME) aoc.bash -p 2 < $(INPUT) 2>&1
+	@$(TIME) aoc-c -p 2 < $(INPUT)
+
+ccls: $(CCLSFILE)
+
+clean:
+	@rm -f aoc-c core* vgcore* gmon.out aoc-c.s aoc-c.i README.html compile_commands.json
+
+aoc-c: aoc-c.c common.c
+	@echo compiling $<
+	$(CC) $(CFLAGS) $(LDFLAGS) -I $(INCDIR) $^ $(LDLIB) -o $@
+
+# generate pre-processed file (.i) and assembler (.s)
+%.i: %.c
+	@echo generating $@
+	@$(CC) -E $(CFLAGS) -I $(INCDIR) $< -o $@
+
+%.s: %.c
+	@echo generating $@
+	@$(CC) -S -fverbose-asm $(CFLAGS) -I $(INCDIR) $< -o $@
+
+# generate README.org from README.html (must cleanup !)
+org: README.org
+
+%.org: %.html
+	@echo generating $@. Cleanup before commit !
+	@pandoc $< -o $@
+
+# generate compile_commands.json
+$(CCLSFILE): aoc-c.c Makefile
+	$(BEAR) -- make clean compile
+
+bear: clean
+	@touch .ccls-root
+	@$(BEAR) -- make compile

2022/day11/README.org

@@ -0,0 +1,364 @@
+** --- Day 11: Monkey in the Middle ---
+As you finally start making your way upriver, you realize your pack is
+much lighter than you remember. Just then, one of the items from your
+pack goes flying overhead. Monkeys are playing
+[[https://en.wikipedia.org/wiki/Keep_away][Keep Away]] with your missing
+things!
+
+To get your stuff back, you need to be able to predict where the monkeys
+will throw your items. After some careful observation, you realize the
+monkeys operate based on /how worried you are about each item/.
+
+You take some notes (your puzzle input) on the items each monkey
+currently has, how worried you are about those items, and how the monkey
+makes decisions based on your worry level. For example:
+
+#+begin_example
+Monkey 0:
+  Starting items: 79, 98
+  Operation: new = old * 19
+  Test: divisible by 23
+    If true: throw to monkey 2
+    If false: throw to monkey 3
+
+Monkey 1:
+  Starting items: 54, 65, 75, 74
+  Operation: new = old + 6
+  Test: divisible by 19
+    If true: throw to monkey 2
+    If false: throw to monkey 0
+
+Monkey 2:
+  Starting items: 79, 60, 97
+  Operation: new = old * old
+  Test: divisible by 13
+    If true: throw to monkey 1
+    If false: throw to monkey 3
+
+Monkey 3:
+  Starting items: 74
+  Operation: new = old + 3
+  Test: divisible by 17
+    If true: throw to monkey 0
+    If false: throw to monkey 1
+#+end_example
+
+Each monkey has several attributes:
+
+- =Starting items= lists your /worry level/ for each item the monkey is
+  currently holding in the order they will be inspected.
+- =Operation= shows how your worry level changes as that monkey inspects
+  an item. (An operation like =new = old * 5= means that your worry
+  level after the monkey inspected the item is five times whatever your
+  worry level was before inspection.)
+- =Test= shows how the monkey uses your worry level to decide where to
+  throw an item next.
+  - =If true= shows what happens with an item if the =Test= was true.
+  - =If false= shows what happens with an item if the =Test= was false.
+
+After each monkey inspects an item but before it tests your worry level,
+your relief that the monkey's inspection didn't damage the item causes
+your worry level to be /divided by three/ and rounded down to the
+nearest integer.
+
+The monkeys take turns inspecting and throwing items. On a single
+monkey's /turn/, it inspects and throws all of the items it is holding
+one at a time and in the order listed. Monkey =0= goes first, then
+monkey =1=, and so on until each monkey has had one turn. The process of
+each monkey taking a single turn is called a /round/.
+
+When a monkey throws an item to another monkey, the item goes on the
+/end/ of the recipient monkey's list. A monkey that starts a round with
+no items could end up inspecting and throwing many items by the time its
+turn comes around. If a monkey is holding no items at the start of its
+turn, its turn ends.
+
+In the above example, the first round proceeds as follows:
+
+#+begin_example
+Monkey 0:
+  Monkey inspects an item with a worry level of 79.
+    Worry level is multiplied by 19 to 1501.
+    Monkey gets bored with item. Worry level is divided by 3 to 500.
+    Current worry level is not divisible by 23.
+    Item with worry level 500 is thrown to monkey 3.
+  Monkey inspects an item with a worry level of 98.
+    Worry level is multiplied by 19 to 1862.
+    Monkey gets bored with item. Worry level is divided by 3 to 620.
+    Current worry level is not divisible by 23.
+    Item with worry level 620 is thrown to monkey 3.
+Monkey 1:
+  Monkey inspects an item with a worry level of 54.
+    Worry level increases by 6 to 60.
+    Monkey gets bored with item. Worry level is divided by 3 to 20.
+    Current worry level is not divisible by 19.
+    Item with worry level 20 is thrown to monkey 0.
+  Monkey inspects an item with a worry level of 65.
+    Worry level increases by 6 to 71.
+    Monkey gets bored with item. Worry level is divided by 3 to 23.
+    Current worry level is not divisible by 19.
+    Item with worry level 23 is thrown to monkey 0.
+  Monkey inspects an item with a worry level of 75.
+    Worry level increases by 6 to 81.
+    Monkey gets bored with item. Worry level is divided by 3 to 27.
+    Current worry level is not divisible by 19.
+    Item with worry level 27 is thrown to monkey 0.
+  Monkey inspects an item with a worry level of 74.
+    Worry level increases by 6 to 80.
+    Monkey gets bored with item. Worry level is divided by 3 to 26.
+    Current worry level is not divisible by 19.
+    Item with worry level 26 is thrown to monkey 0.
+Monkey 2:
+  Monkey inspects an item with a worry level of 79.
+    Worry level is multiplied by itself to 6241.
+    Monkey gets bored with item. Worry level is divided by 3 to 2080.
+    Current worry level is divisible by 13.
+    Item with worry level 2080 is thrown to monkey 1.
+  Monkey inspects an item with a worry level of 60.
+    Worry level is multiplied by itself to 3600.
+    Monkey gets bored with item. Worry level is divided by 3 to 1200.
+    Current worry level is not divisible by 13.
+    Item with worry level 1200 is thrown to monkey 3.
+  Monkey inspects an item with a worry level of 97.
+    Worry level is multiplied by itself to 9409.
+    Monkey gets bored with item. Worry level is divided by 3 to 3136.
+    Current worry level is not divisible by 13.
+    Item with worry level 3136 is thrown to monkey 3.
+Monkey 3:
+  Monkey inspects an item with a worry level of 74.
+    Worry level increases by 3 to 77.
+    Monkey gets bored with item. Worry level is divided by 3 to 25.
+    Current worry level is not divisible by 17.
+    Item with worry level 25 is thrown to monkey 1.
+  Monkey inspects an item with a worry level of 500.
+    Worry level increases by 3 to 503.
+    Monkey gets bored with item. Worry level is divided by 3 to 167.
+    Current worry level is not divisible by 17.
+    Item with worry level 167 is thrown to monkey 1.
+  Monkey inspects an item with a worry level of 620.
+    Worry level increases by 3 to 623.
+    Monkey gets bored with item. Worry level is divided by 3 to 207.
+    Current worry level is not divisible by 17.
+    Item with worry level 207 is thrown to monkey 1.
+  Monkey inspects an item with a worry level of 1200.
+    Worry level increases by 3 to 1203.
+    Monkey gets bored with item. Worry level is divided by 3 to 401.
+    Current worry level is not divisible by 17.
+    Item with worry level 401 is thrown to monkey 1.
+  Monkey inspects an item with a worry level of 3136.
+    Worry level increases by 3 to 3139.
+    Monkey gets bored with item. Worry level is divided by 3 to 1046.
+    Current worry level is not divisible by 17.
+    Item with worry level 1046 is thrown to monkey 1.
+#+end_example
+
+After round 1, the monkeys are holding items with these worry levels:
+
+#+begin_example
+Monkey 0: 20, 23, 27, 26
+Monkey 1: 2080, 25, 167, 207, 401, 1046
+Monkey 2:
+Monkey 3:
+#+end_example
+
+Monkeys 2 and 3 aren't holding any items at the end of the round; they
+both inspected items during the round and threw them all before the
+round ended.
+
+This process continues for a few more rounds:
+
+#+begin_example
+After round 2, the monkeys are holding items with these worry levels:
+Monkey 0: 695, 10, 71, 135, 350
+Monkey 1: 43, 49, 58, 55, 362
+Monkey 2:
+Monkey 3:
+
+After round 3, the monkeys are holding items with these worry levels:
+Monkey 0: 16, 18, 21, 20, 122
+Monkey 1: 1468, 22, 150, 286, 739
+Monkey 2:
+Monkey 3:
+
+After round 4, the monkeys are holding items with these worry levels:
+Monkey 0: 491, 9, 52, 97, 248, 34
+Monkey 1: 39, 45, 43, 258
+Monkey 2:
+Monkey 3:
+
+After round 5, the monkeys are holding items with these worry levels:
+Monkey 0: 15, 17, 16, 88, 1037
+Monkey 1: 20, 110, 205, 524, 72
+Monkey 2:
+Monkey 3:
+
+After round 6, the monkeys are holding items with these worry levels:
+Monkey 0: 8, 70, 176, 26, 34
+Monkey 1: 481, 32, 36, 186, 2190
+Monkey 2:
+Monkey 3:
+
+After round 7, the monkeys are holding items with these worry levels:
+Monkey 0: 162, 12, 14, 64, 732, 17
+Monkey 1: 148, 372, 55, 72
+Monkey 2:
+Monkey 3:
+
+After round 8, the monkeys are holding items with these worry levels:
+Monkey 0: 51, 126, 20, 26, 136
+Monkey 1: 343, 26, 30, 1546, 36
+Monkey 2:
+Monkey 3:
+
+After round 9, the monkeys are holding items with these worry levels:
+Monkey 0: 116, 10, 12, 517, 14
+Monkey 1: 108, 267, 43, 55, 288
+Monkey 2:
+Monkey 3:
+
+After round 10, the monkeys are holding items with these worry levels:
+Monkey 0: 91, 16, 20, 98
+Monkey 1: 481, 245, 22, 26, 1092, 30
+Monkey 2:
+Monkey 3:
+
+...
+
+After round 15, the monkeys are holding items with these worry levels:
+Monkey 0: 83, 44, 8, 184, 9, 20, 26, 102
+Monkey 1: 110, 36
+Monkey 2:
+Monkey 3:
+
+...
+
+After round 20, the monkeys are holding items with these worry levels:
+Monkey 0: 10, 12, 14, 26, 34
+Monkey 1: 245, 93, 53, 199, 115
+Monkey 2:
+Monkey 3:
+#+end_example
+
+Chasing all of the monkeys at once is impossible; you're going to have
+to focus on the /two most active/ monkeys if you want any hope of
+getting your stuff back. Count the /total number of times each monkey
+inspects items/ over 20 rounds:
+
+#+begin_example
+Monkey 0 inspected items 101 times.
+Monkey 1 inspected items 95 times.
+Monkey 2 inspected items 7 times.
+Monkey 3 inspected items 105 times.
+#+end_example
+
+In this example, the two most active monkeys inspected items 101 and 105
+times. The level of /monkey business/ in this situation can be found by
+multiplying these together: =10605=.
+
+Figure out which monkeys to chase by counting how many items they
+inspect over 20 rounds. /What is the level of monkey business after 20
+rounds of stuff-slinging simian shenanigans?/
+
+Your puzzle answer was =54253=.
+
+** --- Part Two ---
+You're worried you might not ever get your items back. So worried, in
+fact, that your relief that a monkey's inspection didn't damage an item
+/no longer causes your worry level to be divided by three/.
+
+Unfortunately, that relief was all that was keeping your worry levels
+from reaching /ridiculous levels/. You'll need to /find another way to
+keep your worry levels manageable/.
+
+At this rate, you might be putting up with these monkeys for a /very
+long time/ - possibly /=10000= rounds/!
+
+With these new rules, you can still figure out the monkey business after
+10000 rounds. Using the same example above:
+
+#+begin_example
+== After round 1 ==
+Monkey 0 inspected items 2 times.
+Monkey 1 inspected items 4 times.
+Monkey 2 inspected items 3 times.
+Monkey 3 inspected items 6 times.
+
+== After round 20 ==
+Monkey 0 inspected items 99 times.
+Monkey 1 inspected items 97 times.
+Monkey 2 inspected items 8 times.
+Monkey 3 inspected items 103 times.
+
+== After round 1000 ==
+Monkey 0 inspected items 5204 times.
+Monkey 1 inspected items 4792 times.
+Monkey 2 inspected items 199 times.
+Monkey 3 inspected items 5192 times.
+
+== After round 2000 ==
+Monkey 0 inspected items 10419 times.
+Monkey 1 inspected items 9577 times.
+Monkey 2 inspected items 392 times.
+Monkey 3 inspected items 10391 times.
+
+== After round 3000 ==
+Monkey 0 inspected items 15638 times.
+Monkey 1 inspected items 14358 times.
+Monkey 2 inspected items 587 times.
+Monkey 3 inspected items 15593 times.
+
+== After round 4000 ==
+Monkey 0 inspected items 20858 times.
+Monkey 1 inspected items 19138 times.
+Monkey 2 inspected items 780 times.
+Monkey 3 inspected items 20797 times.
+
+== After round 5000 ==
+Monkey 0 inspected items 26075 times.
+Monkey 1 inspected items 23921 times.
+Monkey 2 inspected items 974 times.
+Monkey 3 inspected items 26000 times.
+
+== After round 6000 ==
+Monkey 0 inspected items 31294 times.
+Monkey 1 inspected items 28702 times.
+Monkey 2 inspected items 1165 times.
+Monkey 3 inspected items 31204 times.
+
+== After round 7000 ==
+Monkey 0 inspected items 36508 times.
+Monkey 1 inspected items 33488 times.
+Monkey 2 inspected items 1360 times.
+Monkey 3 inspected items 36400 times.
+
+== After round 8000 ==
+Monkey 0 inspected items 41728 times.
+Monkey 1 inspected items 38268 times.
+Monkey 2 inspected items 1553 times.
+Monkey 3 inspected items 41606 times.
+
+== After round 9000 ==
+Monkey 0 inspected items 46945 times.
+Monkey 1 inspected items 43051 times.
+Monkey 2 inspected items 1746 times.
+Monkey 3 inspected items 46807 times.
+
+== After round 10000 ==
+Monkey 0 inspected items 52166 times.
+Monkey 1 inspected items 47830 times.
+Monkey 2 inspected items 1938 times.
+Monkey 3 inspected items 52013 times.
+#+end_example
+
+After 10000 rounds, the two most active monkeys inspected items 52166
+and 52013 times. Multiplying these together, the level of /monkey
+business/ in this situation is now =2713310158=.
+
+Worry levels are no longer divided by three after each item is
+inspected; you'll need to find another way to keep your worry levels
+manageable. Starting again from the initial state in your puzzle input,
+/what is the level of monkey business after 10000 rounds?/
+
+Your puzzle answer was =13119526120=.
+
+Both parts of this puzzle are complete! They provide two gold stars: **